Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1206975..1207595 | Replicon | chromosome |
Accession | NZ_CP099084 | ||
Organism | Citrobacter freundii strain RHB43-C17 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFK79_RS05770 | Protein ID | WP_002892050.1 |
Coordinates | 1206975..1207193 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | NFK79_RS05775 | Protein ID | WP_096758040.1 |
Coordinates | 1207221..1207595 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFK79_RS05740 (1202914) | 1202914..1203525 | + | 612 | WP_181499051.1 | hypothetical protein | - |
NFK79_RS05745 (1203608) | 1203608..1203961 | + | 354 | WP_115259217.1 | DUF1428 family protein | - |
NFK79_RS05750 (1204015) | 1204015..1205568 | - | 1554 | WP_096758043.1 | EAL domain-containing protein | - |
NFK79_RS05755 (1205753) | 1205753..1206013 | + | 261 | WP_096758042.1 | type B 50S ribosomal protein L31 | - |
NFK79_RS05760 (1206015) | 1206015..1206155 | + | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFK79_RS05765 (1206229) | 1206229..1206702 | - | 474 | WP_096758041.1 | YlaC family protein | - |
NFK79_RS05770 (1206975) | 1206975..1207193 | - | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFK79_RS05775 (1207221) | 1207221..1207595 | - | 375 | WP_096758040.1 | Hha toxicity modulator TomB | Antitoxin |
NFK79_RS05780 (1208084) | 1208084..1211233 | - | 3150 | WP_096758039.1 | efflux RND transporter permease AcrB | - |
NFK79_RS05785 (1211256) | 1211256..1212449 | - | 1194 | WP_096758038.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248187 WP_002892050.1 NZ_CP099084:c1207193-1206975 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248187 WP_096758040.1 NZ_CP099084:c1207595-1207221 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSNYGINTQDLQKWRKSGSRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSNYGINTQDLQKWRKSGSRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|