Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4851012..4851628 | Replicon | chromosome |
Accession | NZ_CP099037 | ||
Organism | Citrobacter freundii strain RHB44-SO-C05 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | NFL15_RS23390 | Protein ID | WP_003028682.1 |
Coordinates | 4851012..4851386 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | NFL15_RS23395 | Protein ID | WP_043018956.1 |
Coordinates | 4851386..4851628 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL15_RS23375 (4848515) | 4848515..4849417 | + | 903 | WP_016155183.1 | formate dehydrogenase O subunit beta | - |
NFL15_RS23380 (4849414) | 4849414..4850049 | + | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
NFL15_RS23385 (4850046) | 4850046..4850975 | + | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
NFL15_RS23390 (4851012) | 4851012..4851386 | - | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFL15_RS23395 (4851386) | 4851386..4851628 | - | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
NFL15_RS23400 (4851834) | 4851834..4852742 | + | 909 | WP_032950680.1 | alpha/beta hydrolase | - |
NFL15_RS23405 (4852893) | 4852893..4853834 | - | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
NFL15_RS23410 (4853879) | 4853879..4854316 | - | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
NFL15_RS23415 (4854313) | 4854313..4855185 | - | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
NFL15_RS23420 (4855179) | 4855179..4855778 | - | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T248183 WP_003028682.1 NZ_CP099037:c4851386-4851012 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |