Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 4326098..4326801 | Replicon | chromosome |
| Accession | NZ_CP099037 | ||
| Organism | Citrobacter freundii strain RHB44-SO-C05 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A0L0H2I3 |
| Locus tag | NFL15_RS20885 | Protein ID | WP_021530985.1 |
| Coordinates | 4326098..4326439 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NFL15_RS20890 | Protein ID | WP_126026844.1 |
| Coordinates | 4326460..4326801 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL15_RS20865 (4321123) | 4321123..4322493 | - | 1371 | WP_003837154.1 | tyrosine phenol-lyase | - |
| NFL15_RS20870 (4323272) | 4323272..4323634 | + | 363 | WP_048219798.1 | endoribonuclease SymE | - |
| NFL15_RS20875 (4323787) | 4323787..4324659 | + | 873 | WP_081366016.1 | HNH endonuclease | - |
| NFL15_RS20880 (4324840) | 4324840..4325847 | - | 1008 | WP_004108748.1 | restriction endonuclease | - |
| NFL15_RS20885 (4326098) | 4326098..4326439 | - | 342 | WP_021530985.1 | TA system toxin CbtA family protein | Toxin |
| NFL15_RS20890 (4326460) | 4326460..4326801 | - | 342 | WP_126026844.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFL15_RS20895 (4326812) | 4326812..4327354 | - | 543 | WP_126026845.1 | DNA repair protein RadC | - |
| NFL15_RS20900 (4327367) | 4327367..4327807 | - | 441 | WP_126026846.1 | antirestriction protein | - |
| NFL15_RS20905 (4327838) | 4327838..4328659 | - | 822 | WP_126026847.1 | DUF932 domain-containing protein | - |
| NFL15_RS20910 (4328780) | 4328780..4329253 | - | 474 | WP_126026848.1 | hypothetical protein | - |
| NFL15_RS20915 (4329325) | 4329325..4329777 | - | 453 | WP_031280325.1 | hypothetical protein | - |
| NFL15_RS20920 (4329813) | 4329813..4330529 | - | 717 | WP_001757887.1 | WYL domain-containing protein | - |
| NFL15_RS20925 (4330773) | 4330773..4331648 | - | 876 | WP_126026849.1 | GTPase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12838.71 Da Isoelectric Point: 6.4789
>T248182 WP_021530985.1 NZ_CP099037:c4326439-4326098 [Citrobacter freundii]
MKTLPATNPQAAKLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKARHGEHWE
MKTLPATNPQAAKLCLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
DWQEQSPYLRAVDILRARQATGLLKARHGEHWE
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|