Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3679748..3680368 | Replicon | chromosome |
Accession | NZ_CP099037 | ||
Organism | Citrobacter freundii strain RHB44-SO-C05 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NFL15_RS17920 | Protein ID | WP_002892050.1 |
Coordinates | 3680150..3680368 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | R8WZW8 |
Locus tag | NFL15_RS17915 | Protein ID | WP_003021733.1 |
Coordinates | 3679748..3680122 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFL15_RS17905 (3674894) | 3674894..3676087 | + | 1194 | WP_003835922.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFL15_RS17910 (3676110) | 3676110..3679259 | + | 3150 | WP_003021736.1 | efflux RND transporter permease AcrB | - |
NFL15_RS17915 (3679748) | 3679748..3680122 | + | 375 | WP_003021733.1 | Hha toxicity modulator TomB | Antitoxin |
NFL15_RS17920 (3680150) | 3680150..3680368 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NFL15_RS17925 (3680550) | 3680550..3681101 | + | 552 | WP_138828274.1 | maltose O-acetyltransferase | - |
NFL15_RS17930 (3681218) | 3681218..3681688 | + | 471 | WP_003021724.1 | YlaC family protein | - |
NFL15_RS17935 (3681766) | 3681766..3681906 | - | 141 | WP_005125190.1 | type B 50S ribosomal protein L36 | - |
NFL15_RS17940 (3681908) | 3681908..3682168 | - | 261 | WP_003021719.1 | type B 50S ribosomal protein L31 | - |
NFL15_RS17945 (3682357) | 3682357..3683910 | + | 1554 | WP_003835927.1 | EAL domain-containing protein | - |
NFL15_RS17950 (3683962) | 3683962..3684315 | - | 354 | WP_003831033.1 | DUF1428 family protein | - |
NFL15_RS17955 (3684380) | 3684380..3685009 | - | 630 | WP_016149709.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T248181 WP_002892050.1 NZ_CP099037:3680150-3680368 [Citrobacter freundii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14427.23 Da Isoelectric Point: 5.5653
>AT248181 WP_003021733.1 NZ_CP099037:3679748-3680122 [Citrobacter freundii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEQSNHGWVNDPTSATSLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R8WZW8 |