Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1192075..1192847 | Replicon | chromosome |
| Accession | NZ_CP099037 | ||
| Organism | Citrobacter freundii strain RHB44-SO-C05 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NFL15_RS05765 | Protein ID | WP_032938032.1 |
| Coordinates | 1192075..1192449 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NFL15_RS05770 | Protein ID | WP_049101822.1 |
| Coordinates | 1192488..1192847 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL15_RS05740 (1187757) | 1187757..1187990 | - | 234 | WP_004132711.1 | hypothetical protein | - |
| NFL15_RS05745 (1188390) | 1188390..1188662 | + | 273 | WP_016247220.1 | hypothetical protein | - |
| NFL15_RS05750 (1188865) | 1188865..1189773 | + | 909 | WP_032938037.1 | kdo(2)-lipid IV(A) palmitoleoyltransferase | - |
| NFL15_RS05755 (1190547) | 1190547..1191536 | + | 990 | WP_047058004.1 | glycosyltransferase | - |
| NFL15_RS05760 (1191540) | 1191540..1191995 | + | 456 | WP_223226960.1 | hypothetical protein | - |
| NFL15_RS05765 (1192075) | 1192075..1192449 | - | 375 | WP_032938032.1 | TA system toxin CbtA family protein | Toxin |
| NFL15_RS05770 (1192488) | 1192488..1192847 | - | 360 | WP_049101822.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFL15_RS05775 (1192870) | 1192870..1193091 | - | 222 | WP_032938028.1 | DUF987 domain-containing protein | - |
| NFL15_RS05780 (1193105) | 1193105..1193587 | - | 483 | WP_032938026.1 | DNA repair protein RadC | - |
| NFL15_RS05785 (1193828) | 1193828..1194307 | - | 480 | WP_075206252.1 | antirestriction protein | - |
| NFL15_RS05790 (1194387) | 1194387..1195208 | - | 822 | WP_279279160.1 | DUF932 domain-containing protein | - |
| NFL15_RS05795 (1195319) | 1195319..1195531 | - | 213 | WP_032938024.1 | hypothetical protein | - |
| NFL15_RS05800 (1195641) | 1195641..1196114 | - | 474 | WP_189095326.1 | hypothetical protein | - |
| NFL15_RS05805 (1196188) | 1196188..1196817 | - | 630 | WP_032938019.1 | hypothetical protein | - |
| NFL15_RS05810 (1196915) | 1196915..1197592 | - | 678 | WP_032938016.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1188865..1212421 | 23556 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13903.92 Da Isoelectric Point: 9.7700
>T248176 WP_032938032.1 NZ_CP099037:c1192449-1192075 [Citrobacter freundii]
MQIQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDMLRDRKATGLMTRKGYKTVTDITGGRFSGGK
MQIQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDMLRDRKATGLMTRKGYKTVTDITGGRFSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13393.59 Da Isoelectric Point: 8.8636
>AT248176 WP_049101822.1 NZ_CP099037:c1192847-1192488 [Citrobacter freundii]
MQKATRVINHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDADLRHLDQAFPLLMKQMELMLTSSELM
PRIQRCITLHAKGLICKADTLGSCGYLYIVIYPASATTA
MQKATRVINHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDADLRHLDQAFPLLMKQMELMLTSSELM
PRIQRCITLHAKGLICKADTLGSCGYLYIVIYPASATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|