Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 874862..875523 | Replicon | chromosome |
| Accession | NZ_CP099037 | ||
| Organism | Citrobacter freundii strain RHB44-SO-C05 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | S3IMJ6 |
| Locus tag | NFL15_RS04320 | Protein ID | WP_000698542.1 |
| Coordinates | 875200..875523 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | S3J179 |
| Locus tag | NFL15_RS04315 | Protein ID | WP_000065326.1 |
| Coordinates | 874862..875179 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFL15_RS04270 (870002) | 870002..870826 | + | 825 | WP_000197385.1 | DUF932 domain-containing protein | - |
| NFL15_RS04275 (871035) | 871035..871745 | + | 711 | WP_024198336.1 | hypothetical protein | - |
| NFL15_RS04280 (871771) | 871771..872307 | + | 537 | WP_000219797.1 | DUF4339 domain-containing protein | - |
| NFL15_RS04285 (872349) | 872349..872786 | + | 438 | WP_024198335.1 | hypothetical protein | - |
| NFL15_RS04290 (872853) | 872853..873263 | + | 411 | WP_000912997.1 | hypothetical protein | - |
| NFL15_RS04295 (873341) | 873341..873577 | + | 237 | WP_000004273.1 | DUF905 domain-containing protein | - |
| NFL15_RS04300 (873663) | 873663..874121 | + | 459 | WP_016538084.1 | antirestriction protein | - |
| NFL15_RS04305 (874137) | 874137..874613 | + | 477 | WP_000811694.1 | RadC family protein | - |
| NFL15_RS04310 (874622) | 874622..874843 | + | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
| NFL15_RS04315 (874862) | 874862..875179 | + | 318 | WP_000065326.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NFL15_RS04320 (875200) | 875200..875523 | + | 324 | WP_000698542.1 | TA system toxin CbtA family protein | Toxin |
| NFL15_RS04325 (875764) | 875764..876300 | - | 537 | WP_003033852.1 | GNAT family N-acetyltransferase | - |
| NFL15_RS04330 (877117) | 877117..879579 | + | 2463 | WP_202581010.1 | poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12350.38 Da Isoelectric Point: 8.9789
>T248175 WP_000698542.1 NZ_CP099037:875200-875523 [Citrobacter freundii]
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
MKILPATISRAAKPCLPPVAVWQLLLTRLLEKHYGLTLNDTPFSDETVIKEHFDAGITLANAINFLVEKYELVRIDRRGF
SWQEQTPYLTNIDIMRARRDLGLLNRN
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|