Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 4041645..4042192 | Replicon | chromosome |
| Accession | NZ_CP098926 | ||
| Organism | Halomonas sp. MS1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NF683_RS18705 | Protein ID | WP_253920697.1 |
| Coordinates | 4041645..4041947 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NF683_RS18710 | Protein ID | WP_095603088.1 |
| Coordinates | 4041935..4042192 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NF683_RS18670 (NF683_18665) | 4036848..4037336 | - | 489 | WP_253920692.1 | VOC family protein | - |
| NF683_RS18675 (NF683_18670) | 4037488..4038279 | - | 792 | WP_253920693.1 | type I methionyl aminopeptidase | - |
| NF683_RS18680 (NF683_18675) | 4038272..4038478 | - | 207 | WP_038485042.1 | ParD-like family protein | - |
| NF683_RS18685 (NF683_18680) | 4038619..4039038 | - | 420 | WP_253920694.1 | DUF2784 domain-containing protein | - |
| NF683_RS18690 (NF683_18685) | 4039061..4040275 | - | 1215 | WP_089040879.1 | crosslink repair DNA glycosylase YcaQ family protein | - |
| NF683_RS18695 (NF683_18690) | 4040368..4040772 | - | 405 | WP_253920695.1 | DUF1801 domain-containing protein | - |
| NF683_RS18700 (NF683_18695) | 4040856..4041443 | - | 588 | WP_253920696.1 | O-methyltransferase | - |
| NF683_RS18705 (NF683_18700) | 4041645..4041947 | - | 303 | WP_253920697.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NF683_RS18710 (NF683_18705) | 4041935..4042192 | - | 258 | WP_095603088.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NF683_RS18715 (NF683_18710) | 4042371..4042457 | - | 87 | Protein_3672 | type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family | - |
| NF683_RS18720 (NF683_18715) | 4042551..4043372 | + | 822 | WP_253921906.1 | aldo/keto reductase | - |
| NF683_RS18725 (NF683_18720) | 4043563..4044468 | - | 906 | WP_253920698.1 | EamA family transporter | - |
| NF683_RS18730 (NF683_18725) | 4044637..4045518 | + | 882 | WP_022520598.1 | helix-turn-helix domain-containing protein | - |
| NF683_RS18735 (NF683_18730) | 4045540..4045932 | - | 393 | WP_193084979.1 | N-acetyltransferase | - |
| NF683_RS18740 (NF683_18735) | 4045979..4046860 | - | 882 | WP_253920699.1 | DMT family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11609.31 Da Isoelectric Point: 4.4400
>T248171 WP_253920697.1 NZ_CP098926:c4041947-4041645 [Halomonas sp. MS1]
MAEVIWTEPALQELDAIAEYIALDNPAAASHLVKDVFDKTERLENFPQSGRVPPELPNSVYREIVVLPCRIFYREDEKQV
LVLYVMREERQLRAYMLGNS
MAEVIWTEPALQELDAIAEYIALDNPAAASHLVKDVFDKTERLENFPQSGRVPPELPNSVYREIVVLPCRIFYREDEKQV
LVLYVMREERQLRAYMLGNS
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|