Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 2459052..2459599 | Replicon | chromosome |
Accession | NZ_CP098926 | ||
Organism | Halomonas sp. MS1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NF683_RS11195 | Protein ID | WP_089039028.1 |
Coordinates | 2459052..2459351 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NF683_RS11200 | Protein ID | WP_089039027.1 |
Coordinates | 2459351..2459599 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NF683_RS11170 (NF683_11165) | 2454794..2456020 | - | 1227 | WP_089039032.1 | pyridoxal phosphate-dependent aminotransferase | - |
NF683_RS11175 (NF683_11170) | 2456143..2457009 | + | 867 | WP_089039031.1 | LysR family transcriptional regulator | - |
NF683_RS11180 (NF683_11175) | 2457100..2457864 | + | 765 | WP_089039030.1 | CPBP family intramembrane metalloprotease | - |
NF683_RS11185 (NF683_11180) | 2457889..2458488 | + | 600 | WP_089039029.1 | lysozyme inhibitor LprI family protein | - |
NF683_RS11190 (NF683_11185) | 2458608..2458949 | - | 342 | WP_232471505.1 | hypothetical protein | - |
NF683_RS11195 (NF683_11190) | 2459052..2459351 | - | 300 | WP_089039028.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NF683_RS11200 (NF683_11195) | 2459351..2459599 | - | 249 | WP_089039027.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NF683_RS11205 (NF683_11200) | 2459750..2460883 | + | 1134 | WP_089039026.1 | Fic family protein | - |
NF683_RS11210 (NF683_11205) | 2461031..2461981 | + | 951 | WP_089039025.1 | DUF808 domain-containing protein | - |
NF683_RS11215 (NF683_11210) | 2462165..2463358 | - | 1194 | WP_198361514.1 | CmlA/FloR family chloramphenicol efflux MFS transporter | - |
NF683_RS11220 (NF683_11215) | 2463616..2464407 | - | 792 | WP_089039023.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11927.52 Da Isoelectric Point: 8.0469
>T248170 WP_089039028.1 NZ_CP098926:c2459351-2459052 [Halomonas sp. MS1]
MLSFRITPRARDDLKNIGRYTEWQWGKNQRNTYLKNFEKRFHWLAENPQLGKHRSDVSEGYYSYSQGQHVIFYLIGQECI
EIIGIPHKEMDIVSYFLPE
MLSFRITPRARDDLKNIGRYTEWQWGKNQRNTYLKNFEKRFHWLAENPQLGKHRSDVSEGYYSYSQGQHVIFYLIGQECI
EIIGIPHKEMDIVSYFLPE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|