Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 29701..30293 Replicon plasmid pYUGDPS1-2
Accession NZ_CP098836
Organism Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag NFH28_RS25780 Protein ID WP_000520549.1
Coordinates 30045..30293 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag NFH28_RS25775 Protein ID WP_000681613.1
Coordinates 29701..30048 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFH28_RS25745 (NFH28_25745) 25706..26032 - 327 WP_000008647.1 TrbC/VirB2 family protein -
NFH28_RS25750 (NFH28_25750) 26046..26666 - 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
NFH28_RS25755 (NFH28_25755) 27022..27237 - 216 WP_000760375.1 EexN family lipoprotein -
NFH28_RS25760 (NFH28_25760) 27234..27527 - 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
NFH28_RS25765 (NFH28_25765) 27604..28833 - 1230 WP_252321642.1 DNA relaxase/nickase TaxC -
NFH28_RS25770 (NFH28_25770) 28837..29340 - 504 WP_000781813.1 relaxosome-coupling protein TaxA -
NFH28_RS25775 (NFH28_25775) 29701..30048 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NFH28_RS25780 (NFH28_25780) 30045..30293 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
NFH28_RS25785 (NFH28_25785) 30598..30948 - 351 WP_000854259.1 hypothetical protein -
NFH28_RS25790 (NFH28_25790) 31039..31338 - 300 WP_000650309.1 hypothetical protein -
NFH28_RS25795 (NFH28_25795) 31792..32019 - 228 WP_000801440.1 hypothetical protein -
NFH28_RS25800 (NFH28_25800) 32006..32257 - 252 WP_001230707.1 hypothetical protein -
NFH28_RS25805 (NFH28_25805) 32254..32796 - 543 WP_001083906.1 hypothetical protein -
NFH28_RS25810 (NFH28_25810) 32901..33416 - 516 WP_001025395.1 J domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 - 1..33858 33858


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T248166 WP_000520549.1 NZ_CP098836:c30293-30045 [Salmonella enterica subsp. enterica serovar Typhimurium]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT248166 WP_000681613.1 NZ_CP098836:c30048-29701 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References