Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4446921..4447702 | Replicon | chromosome |
Accession | NZ_CP098834 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | NFH28_RS21955 | Protein ID | WP_000626099.1 |
Coordinates | 4446921..4447412 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NFH28_RS21960 | Protein ID | WP_001110452.1 |
Coordinates | 4447409..4447702 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFH28_RS21915 (4442107) | 4442107..4442349 | - | 243 | WP_197603740.1 | hypothetical protein | - |
NFH28_RS21920 (4442346) | 4442346..4442702 | - | 357 | WP_033567083.1 | hypothetical protein | - |
NFH28_RS21925 (4442699) | 4442699..4443571 | - | 873 | WP_033567082.1 | ParA family protein | - |
NFH28_RS21930 (4443762) | 4443762..4443839 | - | 78 | Protein_4298 | helix-turn-helix domain-containing protein | - |
NFH28_RS21935 (4443930) | 4443930..4444262 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
NFH28_RS21940 (4444334) | 4444334..4444711 | + | 378 | WP_000916345.1 | EthD family reductase | - |
NFH28_RS21945 (4445744) | 4445744..4445818 | + | 75 | Protein_4301 | porin family protein | - |
NFH28_RS21950 (4445921) | 4445921..4446673 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
NFH28_RS21955 (4446921) | 4446921..4447412 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
NFH28_RS21960 (4447409) | 4447409..4447702 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NFH28_RS21965 (4448019) | 4448019..4448240 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NFH28_RS21970 (4448505) | 4448505..4449380 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
NFH28_RS21975 (4449377) | 4449377..4449664 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
NFH28_RS21980 (4449687) | 4449687..4449902 | + | 216 | WP_001595136.1 | hypothetical protein | - |
NFH28_RS21985 (4449910) | 4449910..4450179 | + | 270 | WP_010989096.1 | hypothetical protein | - |
NFH28_RS21990 (4450473) | 4450473..4451378 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T248162 WP_000626099.1 NZ_CP098834:c4447412-4446921 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT248162 WP_001110452.1 NZ_CP098834:c4447702-4447409 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |