Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4236843..4237359 | Replicon | chromosome |
| Accession | NZ_CP098834 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | NFH28_RS20850 | Protein ID | WP_000220578.1 |
| Coordinates | 4236843..4237127 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | NFH28_RS20855 | Protein ID | WP_000212724.1 |
| Coordinates | 4237117..4237359 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFH28_RS20835 (4232055) | 4232055..4233707 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
| NFH28_RS20840 (4234116) | 4234116..4236254 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NFH28_RS20845 (4236375) | 4236375..4236839 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NFH28_RS20850 (4236843) | 4236843..4237127 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NFH28_RS20855 (4237117) | 4237117..4237359 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NFH28_RS20860 (4237437) | 4237437..4239350 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
| NFH28_RS20865 (4239367) | 4239367..4240107 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
| NFH28_RS20870 (4240104) | 4240104..4241222 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| NFH28_RS20875 (4241206) | 4241206..4242339 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T248161 WP_000220578.1 NZ_CP098834:c4237127-4236843 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |