Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3495617..3496237 | Replicon | chromosome |
| Accession | NZ_CP098834 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain GD19PS1 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NFH28_RS17325 | Protein ID | WP_001280991.1 |
| Coordinates | 3496019..3496237 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NFH28_RS17320 | Protein ID | WP_000344807.1 |
| Coordinates | 3495617..3495991 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFH28_RS17310 (3490756) | 3490756..3491949 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NFH28_RS17315 (3491972) | 3491972..3495121 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NFH28_RS17320 (3495617) | 3495617..3495991 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NFH28_RS17325 (3496019) | 3496019..3496237 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NFH28_RS17330 (3496416) | 3496416..3496967 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| NFH28_RS17335 (3497084) | 3497084..3497554 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| NFH28_RS17340 (3497610) | 3497610..3497750 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NFH28_RS17345 (3497756) | 3497756..3498016 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NFH28_RS17350 (3498241) | 3498241..3499791 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
| NFH28_RS17360 (3500022) | 3500022..3500411 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| NFH28_RS17365 (3500444) | 3500444..3501013 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248157 WP_001280991.1 NZ_CP098834:3496019-3496237 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT248157 WP_000344807.1 NZ_CP098834:3495617-3495991 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|