248144

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 55394..56037 Replicon plasmid pYUYZMCS14-1
Accession NZ_CP098832
Organism Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag NFH10_RS23845 Protein ID WP_001044768.1
Coordinates 55621..56037 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag NFH10_RS23840 Protein ID WP_001261287.1
Coordinates 55394..55624 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFH10_RS23805 (NFH10_23805) 50475..50735 + 261 Protein_58 helix-turn-helix domain-containing protein -
NFH10_RS23810 (NFH10_23810) 50918..51331 + 414 Protein_59 serine hydrolase -
NFH10_RS23815 (NFH10_23815) 51394..52098 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NFH10_RS23820 (NFH10_23820) 52148..52891 + 744 Protein_61 class A beta-lactamase -
NFH10_RS23825 (NFH10_23825) 53242..54436 - 1195 Protein_62 IS91 family transposase -
NFH10_RS23830 (NFH10_23830) 54446..54634 - 189 WP_000957857.1 hypothetical protein -
NFH10_RS23835 (NFH10_23835) 54808..55098 - 291 WP_000111771.1 hypothetical protein -
NFH10_RS23840 (NFH10_23840) 55394..55624 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NFH10_RS23845 (NFH10_23845) 55621..56037 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
NFH10_RS23850 (NFH10_23850) 56199..58337 - 2139 WP_000350638.1 AAA family ATPase -
NFH10_RS23855 (NFH10_23855) 58691..58948 + 258 WP_000343085.1 hypothetical protein -
NFH10_RS23860 (NFH10_23860) 58948..59538 + 591 WP_000194575.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-1.1 / oqxB / lnu(F) / ant(3'')-Ia / fosA3 / blaTEM-1B / floR / sul2 / aph(4)-Ia / aac(3)-IVa / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / tet(A) / rmtB / mph(A) / aph(6)-Id / aph(3'')-Ib / aadA5 / dfrA17 - 1..229976 229976


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T248144 WP_001044768.1 NZ_CP098832:55621-56037 [Salmonella enterica subsp. enterica serovar Indiana]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT248144 WP_001261287.1 NZ_CP098832:55394-55624 [Salmonella enterica subsp. enterica serovar Indiana]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References