Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4615126..4615742 Replicon chromosome
Accession NZ_CP098831
Organism Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NFH10_RS22555 Protein ID WP_000238494.1
Coordinates 4615126..4615500 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NFH10_RS22560 Protein ID WP_001523745.1
Coordinates 4615500..4615742 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFH10_RS22540 (4612628) 4612628..4613530 + 903 WP_051129234.1 formate dehydrogenase subunit beta -
NFH10_RS22545 (4613527) 4613527..4614162 + 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
NFH10_RS22550 (4614159) 4614159..4615088 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NFH10_RS22555 (4615126) 4615126..4615500 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NFH10_RS22560 (4615500) 4615500..4615742 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NFH10_RS22565 (4615947) 4615947..4616876 + 930 WP_001162861.1 alpha/beta hydrolase -
NFH10_RS22570 (4616962) 4616962..4617273 + 312 WP_000558165.1 type II toxin-antitoxin system HigB family toxin -
NFH10_RS22575 (4617270) 4617270..4617716 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
NFH10_RS22580 (4617731) 4617731..4618672 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NFH10_RS22585 (4618717) 4618717..4619154 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NFH10_RS22590 (4619151) 4619151..4620023 - 873 WP_000921423.1 virulence factor BrkB family protein -
NFH10_RS22595 (4620017) 4620017..4620616 - 600 WP_023227076.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T248142 WP_000238494.1 NZ_CP098831:c4615500-4615126 [Salmonella enterica subsp. enterica serovar Indiana]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT248142 WP_001523745.1 NZ_CP098831:c4615742-4615500 [Salmonella enterica subsp. enterica serovar Indiana]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References