Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3369136..3369756 | Replicon | chromosome |
Accession | NZ_CP098831 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NFH10_RS16455 | Protein ID | WP_001280991.1 |
Coordinates | 3369538..3369756 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NFH10_RS16450 | Protein ID | WP_000344807.1 |
Coordinates | 3369136..3369510 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFH10_RS16440 (3364275) | 3364275..3365468 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFH10_RS16445 (3365491) | 3365491..3368640 | + | 3150 | WP_252321704.1 | efflux RND transporter permease AcrB | - |
NFH10_RS16450 (3369136) | 3369136..3369510 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NFH10_RS16455 (3369538) | 3369538..3369756 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NFH10_RS16460 (3369935) | 3369935..3370486 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NFH10_RS16465 (3370604) | 3370604..3371074 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NFH10_RS16470 (3371130) | 3371130..3371270 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NFH10_RS16475 (3371276) | 3371276..3371536 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NFH10_RS16480 (3371761) | 3371761..3373311 | + | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
NFH10_RS16490 (3373542) | 3373542..3373931 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NFH10_RS16495 (3373964) | 3373964..3374533 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248138 WP_001280991.1 NZ_CP098831:3369538-3369756 [Salmonella enterica subsp. enterica serovar Indiana]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT248138 WP_000344807.1 NZ_CP098831:3369136-3369510 [Salmonella enterica subsp. enterica serovar Indiana]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|