Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2393137..2393659 | Replicon | chromosome |
Accession | NZ_CP098831 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NFH10_RS11590 | Protein ID | WP_000221343.1 |
Coordinates | 2393375..2393659 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NFH10_RS11585 | Protein ID | WP_000885424.1 |
Coordinates | 2393137..2393385 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFH10_RS11565 (2388779) | 2388779..2390245 | + | 1467 | WP_023893409.1 | hypothetical protein | - |
NFH10_RS24790 (2390276) | 2390276..2390398 | - | 123 | WP_254891910.1 | hypothetical protein | - |
NFH10_RS11570 (2390862) | 2390862..2391149 | + | 288 | WP_071787797.1 | helix-turn-helix domain-containing protein | - |
NFH10_RS11575 (2391221) | 2391221..2392129 | - | 909 | WP_077910000.1 | hypothetical protein | - |
NFH10_RS11580 (2392280) | 2392280..2392612 | - | 333 | WP_023227504.1 | DUF1493 family protein | - |
NFH10_RS11585 (2393137) | 2393137..2393385 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NFH10_RS11590 (2393375) | 2393375..2393659 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFH10_RS11595 (2393707) | 2393707..2393907 | + | 201 | Protein_2271 | Rid family hydrolase | - |
NFH10_RS11600 (2393959) | 2393959..2395038 | - | 1080 | WP_023227502.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NFH10_RS11605 (2395231) | 2395231..2395719 | - | 489 | WP_023227501.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NFH10_RS11610 (2395764) | 2395764..2397272 | + | 1509 | WP_023227500.1 | FAD-dependent oxidoreductase | - |
NFH10_RS11615 (2397262) | 2397262..2398503 | + | 1242 | WP_023227499.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2390294..2400129 | 9835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T248137 WP_000221343.1 NZ_CP098831:2393375-2393659 [Salmonella enterica subsp. enterica serovar Indiana]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |