Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 823309..823934 | Replicon | chromosome |
Accession | NZ_CP098831 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFH10_RS03975 | Protein ID | WP_000911337.1 |
Coordinates | 823536..823934 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | NFH10_RS03970 | Protein ID | WP_000557545.1 |
Coordinates | 823309..823536 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFH10_RS03940 (818354) | 818354..819871 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NFH10_RS03945 (819947) | 819947..820492 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NFH10_RS03950 (820757) | 820757..821515 | + | 759 | WP_000244318.1 | amidase activator ActS | - |
NFH10_RS03960 (821800) | 821800..822606 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
NFH10_RS03965 (822881) | 822881..823141 | - | 261 | WP_023227725.1 | hypothetical protein | - |
NFH10_RS03970 (823309) | 823309..823536 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NFH10_RS03975 (823536) | 823536..823934 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NFH10_RS03980 (824738) | 824738..825274 | + | 537 | WP_023227726.1 | STM3031 family outer membrane protein | - |
NFH10_RS03985 (825321) | 825321..825953 | + | 633 | WP_023227727.1 | YfdX family protein | - |
NFH10_RS03990 (826672) | 826672..827259 | + | 588 | WP_023227728.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 821800..833127 | 11327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T248131 WP_000911337.1 NZ_CP098831:823536-823934 [Salmonella enterica subsp. enterica serovar Indiana]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|