Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 812422..813082 | Replicon | chromosome |
| Accession | NZ_CP098831 | ||
| Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3V4SJP5 |
| Locus tag | NFH10_RS03910 | Protein ID | WP_000244755.1 |
| Coordinates | 812669..813082 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | NFH10_RS03905 | Protein ID | WP_000351186.1 |
| Coordinates | 812422..812688 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NFH10_RS03885 (808729) | 808729..809040 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| NFH10_RS03890 (809204) | 809204..809863 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| NFH10_RS03895 (810121) | 810121..811109 | + | 989 | Protein_764 | IS110 family transposase | - |
| NFH10_RS03900 (811192) | 811192..812172 | - | 981 | WP_017441090.1 | tRNA-modifying protein YgfZ | - |
| NFH10_RS03905 (812422) | 812422..812688 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| NFH10_RS03910 (812669) | 812669..813082 | + | 414 | WP_000244755.1 | protein YgfX | Toxin |
| NFH10_RS03915 (813135) | 813135..813656 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| NFH10_RS03920 (813769) | 813769..814665 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| NFH10_RS03925 (814689) | 814689..815402 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NFH10_RS03930 (815408) | 815408..817141 | + | 1734 | WP_023227724.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16164.10 Da Isoelectric Point: 10.2118
>T248130 WP_000244755.1 NZ_CP098831:812669-813082 [Salmonella enterica subsp. enterica serovar Indiana]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SJP5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |