Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4796947..4797563 Replicon chromosome
Accession NZ_CP098829
Organism Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag NFG92_RS23465 Protein ID WP_000238494.1
Coordinates 4796947..4797321 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag NFG92_RS23470 Protein ID WP_001523745.1
Coordinates 4797321..4797563 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFG92_RS23450 (4794449) 4794449..4795351 + 903 WP_051129234.1 formate dehydrogenase subunit beta -
NFG92_RS23455 (4795348) 4795348..4795983 + 636 WP_000829028.1 formate dehydrogenase cytochrome b556 subunit -
NFG92_RS23460 (4795980) 4795980..4796909 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NFG92_RS23465 (4796947) 4796947..4797321 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
NFG92_RS23470 (4797321) 4797321..4797563 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
NFG92_RS23475 (4797768) 4797768..4798697 + 930 WP_001162861.1 alpha/beta hydrolase -
NFG92_RS23480 (4798783) 4798783..4799094 + 312 WP_000558165.1 type II toxin-antitoxin system HigB family toxin -
NFG92_RS23485 (4799091) 4799091..4799537 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
NFG92_RS23490 (4799552) 4799552..4800493 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NFG92_RS23495 (4800538) 4800538..4800975 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NFG92_RS23500 (4800972) 4800972..4801844 - 873 WP_000921423.1 virulence factor BrkB family protein -
NFG92_RS23505 (4801838) 4801838..4802437 - 600 WP_023227076.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T248128 WP_000238494.1 NZ_CP098829:c4797321-4796947 [Salmonella enterica subsp. enterica serovar Indiana]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT248128 WP_001523745.1 NZ_CP098829:c4797563-4797321 [Salmonella enterica subsp. enterica serovar Indiana]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References