Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4303023..4303539 | Replicon | chromosome |
Accession | NZ_CP098829 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
Locus tag | NFG92_RS21160 | Protein ID | WP_000220577.1 |
Coordinates | 4303023..4303307 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | NFG92_RS21165 | Protein ID | WP_000212724.1 |
Coordinates | 4303297..4303539 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFG92_RS21145 (4298139) | 4298139..4299791 | + | 1653 | WP_000155050.1 | alpha,alpha-phosphotrehalase | - |
NFG92_RS21150 (4300200) | 4300200..4302338 | + | 2139 | WP_023226981.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NFG92_RS21155 (4302555) | 4302555..4303019 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NFG92_RS21160 (4303023) | 4303023..4303307 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFG92_RS21165 (4303297) | 4303297..4303539 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NFG92_RS21170 (4303617) | 4303617..4305530 | - | 1914 | WP_023226980.1 | BglG family transcription antiterminator | - |
NFG92_RS21175 (4305547) | 4305547..4306287 | - | 741 | WP_000779254.1 | KDGP aldolase family protein | - |
NFG92_RS21180 (4306284) | 4306284..4307402 | - | 1119 | WP_023137277.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NFG92_RS21185 (4307386) | 4307386..4308519 | - | 1134 | WP_023226979.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T248127 WP_000220577.1 NZ_CP098829:c4303307-4303023 [Salmonella enterica subsp. enterica serovar Indiana]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |