Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3524772..3525392 | Replicon | chromosome |
Accession | NZ_CP098829 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NFG92_RS17325 | Protein ID | WP_001280991.1 |
Coordinates | 3525174..3525392 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NFG92_RS17320 | Protein ID | WP_000344807.1 |
Coordinates | 3524772..3525146 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFG92_RS17310 (3519911) | 3519911..3521104 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NFG92_RS17315 (3521127) | 3521127..3524276 | + | 3150 | WP_051129102.1 | efflux RND transporter permease AcrB | - |
NFG92_RS17320 (3524772) | 3524772..3525146 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NFG92_RS17325 (3525174) | 3525174..3525392 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NFG92_RS17330 (3525571) | 3525571..3526122 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NFG92_RS17335 (3526240) | 3526240..3526710 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NFG92_RS17340 (3526766) | 3526766..3526906 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NFG92_RS17345 (3526912) | 3526912..3527172 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NFG92_RS17350 (3527397) | 3527397..3528947 | + | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
NFG92_RS17360 (3529178) | 3529178..3529567 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NFG92_RS17365 (3529600) | 3529600..3530169 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T248124 WP_001280991.1 NZ_CP098829:3525174-3525392 [Salmonella enterica subsp. enterica serovar Indiana]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT248124 WP_000344807.1 NZ_CP098829:3524772-3525146 [Salmonella enterica subsp. enterica serovar Indiana]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|