Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2546195..2546717 | Replicon | chromosome |
Accession | NZ_CP098829 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NFG92_RS12460 | Protein ID | WP_000221343.1 |
Coordinates | 2546433..2546717 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NFG92_RS12455 | Protein ID | WP_000885424.1 |
Coordinates | 2546195..2546443 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFG92_RS12435 (2541837) | 2541837..2543303 | + | 1467 | WP_023893409.1 | hypothetical protein | - |
NFG92_RS24480 (2543334) | 2543334..2543456 | - | 123 | WP_254891910.1 | hypothetical protein | - |
NFG92_RS12440 (2543920) | 2543920..2544207 | + | 288 | WP_071787797.1 | helix-turn-helix domain-containing protein | - |
NFG92_RS12445 (2544279) | 2544279..2545187 | - | 909 | WP_077910000.1 | hypothetical protein | - |
NFG92_RS12450 (2545338) | 2545338..2545670 | - | 333 | WP_023227504.1 | DUF1493 family protein | - |
NFG92_RS12455 (2546195) | 2546195..2546443 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NFG92_RS12460 (2546433) | 2546433..2546717 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NFG92_RS12465 (2546765) | 2546765..2546965 | + | 201 | Protein_2445 | Rid family hydrolase | - |
NFG92_RS12470 (2547017) | 2547017..2548096 | - | 1080 | WP_023227502.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NFG92_RS12475 (2548289) | 2548289..2548777 | - | 489 | WP_023227501.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NFG92_RS12480 (2548822) | 2548822..2550330 | + | 1509 | WP_023227500.1 | FAD-dependent oxidoreductase | - |
NFG92_RS12485 (2550320) | 2550320..2551561 | + | 1242 | WP_023227499.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2543352..2553187 | 9835 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T248123 WP_000221343.1 NZ_CP098829:2546433-2546717 [Salmonella enterica subsp. enterica serovar Indiana]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |