Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 1053736..1054550 Replicon chromosome
Accession NZ_CP098829
Organism Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6

Toxin (Protein)


Gene name TacT3 Uniprot ID A0A4Y6MAM1
Locus tag NFG92_RS05125 Protein ID WP_023227563.1
Coordinates 1053736..1054263 (-) Length 176 a.a.

Antitoxin (Protein)


Gene name TacA3 Uniprot ID A0A4Y6M833
Locus tag NFG92_RS05130 Protein ID WP_072162154.1
Coordinates 1054260..1054550 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFG92_RS05100 (1050037) 1050037..1050435 + 399 Protein_1001 cytoplasmic protein -
NFG92_RS05105 (1051021) 1051021..1051689 + 669 WP_000445914.1 hypothetical protein -
NFG92_RS05110 (1051716) 1051716..1052210 + 495 WP_023227564.1 hypothetical protein -
NFG92_RS05115 (1052455) 1052455..1053111 - 657 WP_000420452.1 protein-serine/threonine phosphatase -
NFG92_RS05120 (1053446) 1053446..1053663 + 218 Protein_1005 IS5/IS1182 family transposase -
NFG92_RS05125 (1053736) 1053736..1054263 - 528 WP_023227563.1 GNAT family N-acetyltransferase Toxin
NFG92_RS05130 (1054260) 1054260..1054550 - 291 WP_072162154.1 DUF1778 domain-containing protein Antitoxin
NFG92_RS05135 (1054820) 1054820..1054998 - 179 Protein_1008 IS3 family transposase -
NFG92_RS05140 (1055239) 1055239..1055565 + 327 WP_000393302.1 hypothetical protein -
NFG92_RS05145 (1055838) 1055838..1056185 - 348 WP_001669174.1 DUF1493 family protein -
NFG92_RS05150 (1056170) 1056170..1056619 - 450 WP_000381610.1 membrane protein -
NFG92_RS05155 (1057050) 1057050..1057493 - 444 WP_000715096.1 SPI-1 type III secretion system invasion lipoprotein InvH -
NFG92_RS05160 (1057795) 1057795..1058492 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
NFG92_RS05165 (1058508) 1058508..1058852 + 345 Protein_1014 type III secretion system transcriptional activator InvF -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - invH / invG / invE / invA / invB 1052455..1064165 11710
- inside IScluster/Tn - invH 1053523..1058492 4969


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Vibrio phage ICP1, Orf50

(1-95)


Sequences

Toxin        


Download         Length: 176 a.a.        Molecular weight: 19099.93 Da        Isoelectric Point: 9.6420

>T248117 WP_023227563.1 NZ_CP098829:c1054263-1053736 [Salmonella enterica subsp. enterica serovar Indiana]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGSVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Download         Length: 528 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10664.54 Da        Isoelectric Point: 8.5779

>AT248117 WP_072162154.1 NZ_CP098829:c1054550-1054260 [Salmonella enterica subsp. enterica serovar Indiana]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Y6MAM1

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y6M833

References