Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 896170..896795 | Replicon | chromosome |
Accession | NZ_CP098829 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS6 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFG92_RS04420 | Protein ID | WP_000911337.1 |
Coordinates | 896397..896795 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | NFG92_RS04415 | Protein ID | WP_000557545.1 |
Coordinates | 896170..896397 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFG92_RS04385 (891215) | 891215..892732 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NFG92_RS04390 (892808) | 892808..893353 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NFG92_RS04395 (893618) | 893618..894376 | + | 759 | WP_000244318.1 | amidase activator ActS | - |
NFG92_RS04405 (894661) | 894661..895467 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
NFG92_RS04410 (895742) | 895742..896002 | - | 261 | WP_023227725.1 | hypothetical protein | - |
NFG92_RS04415 (896170) | 896170..896397 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NFG92_RS04420 (896397) | 896397..896795 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NFG92_RS04425 (897599) | 897599..898135 | + | 537 | WP_023227726.1 | STM3031 family outer membrane protein | - |
NFG92_RS04430 (898182) | 898182..898814 | + | 633 | WP_023227727.1 | YfdX family protein | - |
NFG92_RS04435 (899533) | 899533..900120 | + | 588 | WP_023227728.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 894661..905988 | 11327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T248116 WP_000911337.1 NZ_CP098829:896397-896795 [Salmonella enterica subsp. enterica serovar Indiana]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|