Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1257354..1258024 | Replicon | plasmid pB |
Accession | NZ_CP098809 | ||
Organism | Ensifer adhaerens strain M8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NE863_RS32885 | Protein ID | WP_252160988.1 |
Coordinates | 1257354..1257773 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NE863_RS32890 | Protein ID | WP_034798588.1 |
Coordinates | 1257770..1258024 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE863_RS32860 (NE863_32860) | 1252675..1253547 | - | 873 | WP_252160984.1 | DMT family transporter | - |
NE863_RS32865 (NE863_32865) | 1253555..1254526 | - | 972 | WP_060644205.1 | amino acid ABC transporter permease | - |
NE863_RS32870 (NE863_32870) | 1254556..1255836 | - | 1281 | WP_252160985.1 | FAD-binding oxidoreductase | - |
NE863_RS32875 (NE863_32875) | 1255896..1256723 | - | 828 | WP_252160986.1 | transporter substrate-binding domain-containing protein | - |
NE863_RS32880 (NE863_32880) | 1257028..1257282 | - | 255 | WP_252160987.1 | hypothetical protein | - |
NE863_RS32885 (NE863_32885) | 1257354..1257773 | - | 420 | WP_252160988.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NE863_RS32890 (NE863_32890) | 1257770..1258024 | - | 255 | WP_034798588.1 | plasmid stabilization protein | Antitoxin |
NE863_RS32895 (NE863_32895) | 1258200..1258379 | - | 180 | Protein_1135 | DNA ligase | - |
NE863_RS32900 (NE863_32900) | 1258538..1258891 | - | 354 | WP_034798587.1 | response regulator | - |
NE863_RS32905 (NE863_32905) | 1258915..1259907 | - | 993 | WP_127890243.1 | PAS domain-containing sensor histidine kinase | - |
NE863_RS32910 (NE863_32910) | 1260833..1261084 | + | 252 | WP_063979521.1 | hypothetical protein | - |
NE863_RS32915 (NE863_32915) | 1261072..1261473 | - | 402 | Protein_1139 | hypothetical protein | - |
NE863_RS32920 (NE863_32920) | 1261927..1262154 | - | 228 | WP_082936641.1 | helix-turn-helix domain-containing protein | - |
NE863_RS32925 (NE863_32925) | 1262301..1262984 | + | 684 | WP_252160989.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..1701077 | 1701077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14866.98 Da Isoelectric Point: 4.6556
>T248113 WP_252160988.1 NZ_CP098809:c1257773-1257354 [Ensifer adhaerens]
MIVLDTNVVSEAMKPAPDLAVRNWLNDQVAETLFLSSVTLAELLFGIAALPEGRRKKALADTLDGLLELFDDRVLSFDPA
AARHYADLTATARAVGKGFQTPDGYIAAIAASKGFTIATRDTSPFEAAGVPVVNPWNHL
MIVLDTNVVSEAMKPAPDLAVRNWLNDQVAETLFLSSVTLAELLFGIAALPEGRRKKALADTLDGLLELFDDRVLSFDPA
AARHYADLTATARAVGKGFQTPDGYIAAIAASKGFTIATRDTSPFEAAGVPVVNPWNHL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|