Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-CC2985 |
Location | 758603..759144 | Replicon | plasmid pB |
Accession | NZ_CP098809 | ||
Organism | Ensifer adhaerens strain M8 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A1H0CJK8 |
Locus tag | NE863_RS30700 | Protein ID | WP_034798189.1 |
Coordinates | 758603..758896 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1H0CJP6 |
Locus tag | NE863_RS30705 | Protein ID | WP_034798187.1 |
Coordinates | 758896..759144 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE863_RS30675 (NE863_30675) | 754602..755075 | - | 474 | WP_090302489.1 | SRPBCC family protein | - |
NE863_RS30680 (NE863_30680) | 755068..755583 | - | 516 | WP_252161401.1 | SgcJ/EcaC family oxidoreductase | - |
NE863_RS30685 (NE863_30685) | 755583..755831 | - | 249 | WP_060529873.1 | hypothetical protein | - |
NE863_RS30690 (NE863_30690) | 755927..756865 | + | 939 | WP_252161402.1 | LysR family transcriptional regulator | - |
NE863_RS30695 (NE863_30695) | 757092..758531 | + | 1440 | WP_252161403.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
NE863_RS30700 (NE863_30700) | 758603..758896 | - | 294 | WP_034798189.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NE863_RS30705 (NE863_30705) | 758896..759144 | - | 249 | WP_034798187.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NE863_RS30710 (NE863_30710) | 759415..760872 | + | 1458 | WP_250806794.1 | MDR family MFS transporter | - |
NE863_RS30715 (NE863_30715) | 760923..763616 | - | 2694 | WP_252161404.1 | TonB-dependent receptor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..1701077 | 1701077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10969.62 Da Isoelectric Point: 6.9895
>T248112 WP_034798189.1 NZ_CP098809:c758896-758603 [Ensifer adhaerens]
MAFRLSVAAEEDIIAIAADGVRLFGSAQARRYHDELFAVFALIAANPRMARERTELSPPMRIHPFKAHLVVYRVEADGDI
LVVRVRHGHEDWISNAF
MAFRLSVAAEEDIIAIAADGVRLFGSAQARRYHDELFAVFALIAANPRMARERTELSPPMRIHPFKAHLVVYRVEADGDI
LVVRVRHGHEDWISNAF
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H0CJK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H0CJP6 |