Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1119012..1119712 | Replicon | plasmid pA |
Accession | NZ_CP098808 | ||
Organism | Ensifer adhaerens strain M8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NE863_RS24385 | Protein ID | WP_252160673.1 |
Coordinates | 1119275..1119712 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1H0BN26 |
Locus tag | NE863_RS24380 | Protein ID | WP_034800189.1 |
Coordinates | 1119012..1119278 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE863_RS24360 (NE863_24360) | 1115351..1116400 | + | 1050 | WP_060529687.1 | ABC transporter permease | - |
NE863_RS24365 (NE863_24365) | 1116402..1117343 | + | 942 | WP_034800188.1 | ABC transporter permease | - |
NE863_RS24370 (NE863_24370) | 1117340..1118632 | + | 1293 | WP_252160672.1 | amidohydrolase family protein | - |
NE863_RS24375 (NE863_24375) | 1118679..1118833 | - | 155 | Protein_993 | transcriptional regulator | - |
NE863_RS24380 (NE863_24380) | 1119012..1119278 | + | 267 | WP_034800189.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NE863_RS24385 (NE863_24385) | 1119275..1119712 | + | 438 | WP_252160673.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NE863_RS24390 (NE863_24390) | 1119989..1120237 | + | 249 | WP_060643745.1 | hypothetical protein | - |
NE863_RS24395 (NE863_24395) | 1120454..1121494 | + | 1041 | WP_060643746.1 | ABC transporter substrate-binding protein | - |
NE863_RS24400 (NE863_24400) | 1121575..1122384 | + | 810 | WP_246802053.1 | ABC transporter permease | - |
NE863_RS24405 (NE863_24405) | 1122400..1123203 | + | 804 | WP_113136167.1 | ABC transporter permease | - |
NE863_RS24410 (NE863_24410) | 1123200..1124288 | + | 1089 | WP_089045655.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | katA | 1..1753114 | 1753114 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15364.78 Da Isoelectric Point: 6.9280
>T248110 WP_252160673.1 NZ_CP098808:1119275-1119712 [Ensifer adhaerens]
VSNLFMLDTNIVFELARNPRGQVAERIAAVGSEAICVSIITAAELRYGCAKKGSPKLLAQIEALLESILVLALDVPADAK
YGNIRTELEAAGKPIGPNDLLIAAHACAAGAVLVTANAREFTRIPNLRVENWLDATSKQLRGASN
VSNLFMLDTNIVFELARNPRGQVAERIAAVGSEAICVSIITAAELRYGCAKKGSPKLLAQIEALLESILVLALDVPADAK
YGNIRTELEAAGKPIGPNDLLIAAHACAAGAVLVTANAREFTRIPNLRVENWLDATSKQLRGASN
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|