Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-dnstrm_HI1420
Location 1436343..1436961 Replicon chromosome
Accession NZ_CP098807
Organism Ensifer adhaerens strain M8

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag NE863_RS07100 Protein ID WP_250806402.1
Coordinates 1436671..1436961 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NE863_RS07095 Protein ID WP_250806401.1
Coordinates 1436343..1436669 (-) Length 109 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE863_RS07050 (NE863_07050) 1431462..1431956 + 495 WP_252160522.1 hypothetical protein -
NE863_RS07055 (NE863_07055) 1431956..1432318 + 363 WP_252160523.1 hypothetical protein -
NE863_RS07060 (NE863_07060) 1432326..1432898 - 573 WP_252160524.1 hypothetical protein -
NE863_RS07065 (NE863_07065) 1432996..1434033 + 1038 WP_252160525.1 phage minor head protein -
NE863_RS07070 (NE863_07070) 1434033..1434479 + 447 WP_252160526.1 HK97 gp10 family phage protein -
NE863_RS07075 (NE863_07075) 1434686..1435111 + 426 WP_252160527.1 phage tail terminator-like protein -
NE863_RS07080 (NE863_07080) 1435113..1435598 + 486 WP_057252464.1 hypothetical protein -
NE863_RS07085 (NE863_07085) 1435613..1436002 + 390 WP_090429185.1 hypothetical protein -
NE863_RS07090 (NE863_07090) 1436110..1436346 + 237 WP_252160528.1 hypothetical protein -
NE863_RS07095 (NE863_07095) 1436343..1436669 - 327 WP_250806401.1 putative addiction module antidote protein Antitoxin
NE863_RS07100 (NE863_07100) 1436671..1436961 - 291 WP_250806402.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE863_RS07105 (NE863_07105) 1437085..1437939 + 855 WP_250806403.1 hypothetical protein -
NE863_RS07110 (NE863_07110) 1437953..1438132 - 180 WP_250806404.1 hypothetical protein -
NE863_RS07115 (NE863_07115) 1438178..1438639 - 462 WP_252160529.1 hypothetical protein -
NE863_RS07120 (NE863_07120) 1438700..1440811 + 2112 WP_252160530.1 phage tail length tape measure family protein -
NE863_RS07125 (NE863_07125) 1440814..1441467 + 654 WP_250806407.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1403686..1456703 53017


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-95)

Antitoxin

Uncharacterized protein HI1420

(5-91)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 10595.20 Da        Isoelectric Point: 9.5483

>T248108 WP_250806402.1 NZ_CP098807:c1436961-1436671 [Ensifer adhaerens]
MIEVRQTDIFSDWLAGLRDKNAKAKIVARIRRLELGNPGDVKPVGEGVSEMRVDYGPGYRVYFVSQGDTVVILLCAGDKS
SQSNDIAKAKRLAKEI

Download         Length: 291 bp

Antitoxin


Download         Length: 109 a.a.        Molecular weight: 11496.03 Da        Isoelectric Point: 4.6672

>AT248108 WP_250806401.1 NZ_CP098807:c1436669-1436343 [Ensifer adhaerens]
MALRTTRFDVQDHLKTPEERLAYLEAAFDDGDPALIAHSLGDVARSLGMSDVAKKAGVTREALYKALSENGDPKLSTLLG
VVAALGIKLSVAPAEVDTDNYAETRLAP

Download         Length: 327 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References