Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 4464673..4465268 | Replicon | chromosome |
Accession | NZ_CP098806 | ||
Organism | Dyadobacter fanqingshengii strain CY399 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFI81_RS18525 | Protein ID | WP_234610996.1 |
Coordinates | 4464882..4465268 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NFI81_RS18520 | Protein ID | WP_234610997.1 |
Coordinates | 4464673..4464885 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFI81_RS18505 (NFI81_18490) | 4459992..4461740 | - | 1749 | WP_234611000.1 | response regulator | - |
NFI81_RS18510 (NFI81_18495) | 4461878..4463275 | - | 1398 | WP_234610999.1 | dihydrolipoyl dehydrogenase | - |
NFI81_RS18515 (NFI81_18500) | 4463497..4464571 | + | 1075 | WP_234610998.1 | peptide chain release factor 2 | - |
NFI81_RS18520 (NFI81_18505) | 4464673..4464885 | + | 213 | WP_234610997.1 | DUF2281 domain-containing protein | Antitoxin |
NFI81_RS18525 (NFI81_18510) | 4464882..4465268 | + | 387 | WP_234610996.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFI81_RS18530 (NFI81_18515) | 4465268..4466056 | + | 789 | WP_234610995.1 | alpha/beta hydrolase | - |
NFI81_RS18535 (NFI81_18520) | 4466080..4467369 | + | 1290 | WP_234610994.1 | MFS transporter | - |
NFI81_RS18540 (NFI81_18525) | 4467450..4467884 | + | 435 | WP_234610993.1 | DoxX family protein | - |
NFI81_RS18545 (NFI81_18530) | 4467888..4468763 | - | 876 | WP_234610992.1 | AraC family transcriptional regulator | - |
NFI81_RS18550 (NFI81_18535) | 4468920..4469252 | - | 333 | WP_234610991.1 | RNA polymerase subunit sigma-24 | - |
NFI81_RS18555 (NFI81_18540) | 4469282..4470253 | - | 972 | WP_234610990.1 | dihydrodipicolinate synthase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14860.32 Da Isoelectric Point: 5.0944
>T248107 WP_234610996.1 NZ_CP098806:4464882-4465268 [Dyadobacter fanqingshengii]
MNIILDTHTLIWFFEGDANLSAKALQAIENTENKKYVSIASLWEMAIKISLGKLYLQKPLDIFLSDLIKSDIEVLQISIA
HVLQVSQLEFFHKDPFDRIIVAQAITEQFWIVTKDPNFPLYHPFNVLW
MNIILDTHTLIWFFEGDANLSAKALQAIENTENKKYVSIASLWEMAIKISLGKLYLQKPLDIFLSDLIKSDIEVLQISIA
HVLQVSQLEFFHKDPFDRIIVAQAITEQFWIVTKDPNFPLYHPFNVLW
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|