Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 4248049..4248641 | Replicon | chromosome |
Accession | NZ_CP098805 | ||
Organism | Dyadobacter chenhuakuii strain CY22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NFI80_RS17565 | Protein ID | WP_235165538.1 |
Coordinates | 4248258..4248641 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NFI80_RS17560 | Protein ID | WP_235165537.1 |
Coordinates | 4248049..4248261 (+) | Length | 71 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFI80_RS17545 (NFI80_17545) | 4243306..4245063 | - | 1758 | WP_235165535.1 | response regulator | - |
NFI80_RS17550 (NFI80_17550) | 4245200..4246597 | - | 1398 | WP_233794784.1 | dihydrolipoyl dehydrogenase | - |
NFI80_RS17555 (NFI80_17555) | 4246876..4247950 | + | 1075 | WP_157486611.1 | peptide chain release factor 2 | - |
NFI80_RS17560 (NFI80_17560) | 4248049..4248261 | + | 213 | WP_235165537.1 | DUF2281 domain-containing protein | Antitoxin |
NFI80_RS17565 (NFI80_17565) | 4248258..4248641 | + | 384 | WP_235165538.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NFI80_RS17570 (NFI80_17570) | 4248641..4249429 | + | 789 | WP_235165540.1 | alpha/beta hydrolase | - |
NFI80_RS17575 (NFI80_17575) | 4249453..4250742 | + | 1290 | WP_235165541.1 | MFS transporter | - |
NFI80_RS17580 (NFI80_17580) | 4250823..4251257 | + | 435 | WP_233794780.1 | DoxX family protein | - |
NFI80_RS17585 (NFI80_17585) | 4251261..4252136 | - | 876 | WP_026629464.1 | AraC family transcriptional regulator | - |
NFI80_RS17590 (NFI80_17590) | 4252274..4252624 | - | 351 | WP_235161189.1 | RNA polymerase subunit sigma-24 | - |
NFI80_RS17595 (NFI80_17595) | 4252656..4253627 | - | 972 | WP_235165542.1 | dihydrodipicolinate synthase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14482.81 Da Isoelectric Point: 4.6005
>T248104 WP_235165538.1 NZ_CP098805:4248258-4248641 [Dyadobacter chenhuakuii]
MNIILDTHALIWFFEGDSNLSAKALEAIENTNNKKFVSVASLWEIAIKTSLGKLTLQKPLDTFLSELVQSDIQILPISIN
QVLLVSQLDFFHKDPFDRIIIAQSITEKFPVVTKDPSFLLYPTDLYW
MNIILDTHALIWFFEGDSNLSAKALEAIENTNNKKFVSVASLWEIAIKTSLGKLTLQKPLDTFLSELVQSDIQILPISIN
QVLLVSQLDFFHKDPFDRIIIAQSITEKFPVVTKDPSFLLYPTDLYW
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|