Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 430727..431397 | Replicon | plasmid pRA_T24_1 |
| Accession | NZ_CP098801 | ||
| Organism | Rhizobium anhuiense bv. trifolii strain T24 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NE851_RS02145 | Protein ID | WP_097544206.1 |
| Coordinates | 430978..431397 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NE851_RS02140 | Protein ID | WP_097544240.1 |
| Coordinates | 430727..430981 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE851_RS02120 (NE851_02110) | 425924..426550 | - | 627 | WP_028757558.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| NE851_RS02125 (NE851_02115) | 426650..427624 | - | 975 | WP_097544204.1 | alpha/beta hydrolase | - |
| NE851_RS02130 (NE851_02120) | 428056..429963 | + | 1908 | WP_097544205.1 | PAS domain S-box protein | - |
| NE851_RS02135 (NE851_02125) | 429953..430576 | + | 624 | WP_028757555.1 | response regulator | - |
| NE851_RS02140 (NE851_02130) | 430727..430981 | + | 255 | WP_097544240.1 | plasmid stabilization protein | Antitoxin |
| NE851_RS02145 (NE851_02135) | 430978..431397 | + | 420 | WP_097544206.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NE851_RS02150 (NE851_02140) | 431482..432315 | - | 834 | WP_097544241.1 | AraC family transcriptional regulator | - |
| NE851_RS02155 (NE851_02145) | 432608..433513 | + | 906 | WP_245433438.1 | AraC family transcriptional regulator | - |
| NE851_RS02160 (NE851_02150) | 433646..434626 | - | 981 | WP_097544207.1 | alpha/beta hydrolase | - |
| NE851_RS02165 (NE851_02155) | 434694..436292 | - | 1599 | WP_097544208.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..1441560 | 1441560 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15213.53 Da Isoelectric Point: 5.7251
>T248101 WP_097544206.1 NZ_CP098801:430978-431397 [Rhizobium anhuiense bv. trifolii]
MILLDTNVLSEPWKPAPDERVVAWLDAQAIETLFLSVMTIAELRFGIAAMPLGKRQTILHDRLEGEVLPHFSERILSFNL
ASSQFYSELMVRARVSGRTIGTSDGYIAATAAANGLAVATRDTSPFEAAGLKVINPWAR
MILLDTNVLSEPWKPAPDERVVAWLDAQAIETLFLSVMTIAELRFGIAAMPLGKRQTILHDRLEGEVLPHFSERILSFNL
ASSQFYSELMVRARVSGRTIGTSDGYIAATAAANGLAVATRDTSPFEAAGLKVINPWAR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|