Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 321015..321814 | Replicon | plasmid pRA_T24_1 |
Accession | NZ_CP098801 | ||
Organism | Rhizobium anhuiense bv. trifolii strain T24 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | NE851_RS01575 | Protein ID | WP_254955871.1 |
Coordinates | 321311..321814 (+) | Length | 168 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | NE851_RS01570 | Protein ID | WP_097623327.1 |
Coordinates | 321015..321314 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE851_RS01555 (NE851_01550) | 316932..318299 | - | 1368 | WP_097623324.1 | metallophosphoesterase | - |
NE851_RS01560 (NE851_01555) | 318296..319609 | - | 1314 | WP_097623325.1 | protein kinase | - |
NE851_RS01565 (NE851_01560) | 319627..320523 | - | 897 | WP_097623326.1 | vWA domain-containing protein | - |
NE851_RS01570 (NE851_01565) | 321015..321314 | + | 300 | WP_097623327.1 | DUF1778 domain-containing protein | Antitoxin |
NE851_RS01575 (NE851_01570) | 321311..321814 | + | 504 | WP_254955871.1 | GNAT family N-acetyltransferase | Toxin |
NE851_RS01580 (NE851_01575) | 322246..322755 | - | 510 | WP_097623329.1 | hypothetical protein | - |
NE851_RS01585 (NE851_01580) | 322977..323279 | + | 303 | WP_097623330.1 | hypothetical protein | - |
NE851_RS01590 (NE851_01585) | 323741..323932 | + | 192 | WP_143541139.1 | IS66 family insertion sequence element accessory protein TnpB | - |
NE851_RS01595 (NE851_01590) | 324295..324489 | - | 195 | WP_097623331.1 | hypothetical protein | - |
NE851_RS01600 (NE851_01595) | 324616..324946 | + | 331 | Protein_319 | terminase small subunit protein | - |
NE851_RS01605 (NE851_01600) | 325142..325882 | + | 741 | WP_245445217.1 | TIM barrel protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | htpB | 1..1441560 | 1441560 | |
- | flank | IS/Tn | - | - | 323741..323932 | 191 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 168 a.a. Molecular weight: 18167.74 Da Isoelectric Point: 9.6204
>T248100 WP_254955871.1 NZ_CP098801:321311-321814 [Rhizobium anhuiense bv. trifolii]
VTLSAPIPLADHHELSEFNSSVPELNDWLRRRARANQVGGASRTFVVCEENRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDQSYQGRGIGRALVRDAGLRLLNAAEILGIRGVFVHAISNDARAFYQAVGFLPSPSDPMMRMVGLNDFS
SALNSQP
VTLSAPIPLADHHELSEFNSSVPELNDWLRRRARANQVGGASRTFVVCEENRVIAYYALASGAVKQPEAPGRFRRNMPDP
IPVAVLGRLAIDQSYQGRGIGRALVRDAGLRLLNAAEILGIRGVFVHAISNDARAFYQAVGFLPSPSDPMMRMVGLNDFS
SALNSQP
Download Length: 504 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|