Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 234946..235544 Replicon plasmid pRA_T24_1
Accession NZ_CP098801
Organism Rhizobium anhuiense bv. trifolii strain T24

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NE851_RS01130 Protein ID WP_168333864.1
Coordinates 235251..235544 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NE851_RS01125 Protein ID WP_168333863.1
Coordinates 234946..235254 (+) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE851_RS01090 230057..230179 + 123 WP_254955743.1 hypothetical protein -
NE851_RS01095 (NE851_01090) 230194..230988 - 795 WP_152093828.1 IS21-like element helper ATPase IstB -
NE851_RS01100 (NE851_01095) 230978..232498 - 1521 WP_254955750.1 IS21 family transposase -
NE851_RS01105 (NE851_01100) 232746..233024 + 279 WP_097596198.1 DUF1778 domain-containing protein -
NE851_RS01110 (NE851_01105) 233021..233548 + 528 WP_097596161.1 GNAT family N-acetyltransferase -
NE851_RS01115 (NE851_01110) 233714..234112 + 399 Protein_222 integrase core domain-containing protein -
NE851_RS01120 (NE851_01115) 234375..234560 + 186 Protein_223 IS110 family transposase -
NE851_RS01125 (NE851_01120) 234946..235254 + 309 WP_168333863.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NE851_RS01130 (NE851_01125) 235251..235544 + 294 WP_168333864.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE851_RS01135 (NE851_01130) 235770..236381 - 612 WP_183845504.1 L,D-transpeptidase -
NE851_RS01140 (NE851_01135) 236523..237053 + 531 WP_254955763.1 GNAT family protein -
NE851_RS01145 (NE851_01140) 237287..237574 - 288 WP_254955765.1 hypothetical protein -
NE851_RS01150 (NE851_01145) 238346..238642 - 297 WP_254955767.1 hypothetical protein -
NE851_RS01155 (NE851_01150) 238658..238945 - 288 WP_254955769.1 hypothetical protein -
NE851_RS01160 (NE851_01155) 239162..239368 + 207 WP_254956343.1 DUF2807 domain-containing protein -
NE851_RS01165 (NE851_01160) 239490..239918 + 429 WP_183906535.1 DUF4259 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB 1..1441560 1441560
- inside IScluster/Tn - - 230194..234112 3918


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-90)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-53)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 10635.22 Da        Isoelectric Point: 7.0106

>T248099 WP_168333864.1 NZ_CP098801:235251-235544 [Rhizobium anhuiense bv. trifolii]
VKLIWSAFALSDRDAIFTYIEAENPSAAILVDERIVAAVRRLVDFPASGRVGRIAGTRELAINGTPYVAAYAITETAVRI
LRVLHGAQEWPDTLPTR

Download         Length: 294 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 10996.35 Da        Isoelectric Point: 5.1457

>AT248099 WP_168333863.1 NZ_CP098801:234946-235254 [Rhizobium anhuiense bv. trifolii]
MAANALVQTRIDADVRDRASAVLGNMGLTVSDAVRILLTRTANEGALPLELLSGSEAHDAWFRTKVLEALNDIRPDVSDD
EVEAHFAERRAAARLNAGARKS

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References