248097

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) BrnTA/BrnT-BrnA
Location 91615..92203 Replicon plasmid p1VB280821
Accession NZ_CP098796
Organism Acinetobacter baumannii strain VB280821

Toxin (Protein)


Gene name brnT Uniprot ID N8SM64
Locus tag NE424_RS19805 Protein ID WP_000438825.1
Coordinates 91615..91902 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name brnA Uniprot ID D3JXQ4
Locus tag NE424_RS19810 Protein ID WP_004728120.1
Coordinates 91889..92203 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE424_RS19775 (NE424_19775) 87067..87486 + 420 WP_001180106.1 SMI1/KNR4 family protein -
NE424_RS19780 (NE424_19780) 87586..88794 - 1209 WP_042090285.1 IS256 family transposase -
NE424_RS19785 (NE424_19785) 88894..89175 - 282 WP_000985609.1 putative addiction module antidote protein -
NE424_RS19790 (NE424_19790) 89176..89478 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
NE424_RS19795 (NE424_19795) 89771..90861 + 1091 WP_252172194.1 IS4-like element ISAba33 family transposase -
NE424_RS19800 (NE424_19800) 90858..91346 + 489 WP_252172183.1 hypothetical protein -
NE424_RS19805 (NE424_19805) 91615..91902 + 288 WP_000438825.1 BrnT family toxin Toxin
NE424_RS19810 (NE424_19810) 91889..92203 + 315 WP_004728120.1 BrnA antitoxin family protein Antitoxin
NE424_RS19815 (NE424_19815) 92253..92651 - 399 WP_080768162.1 LysE family transporter -
NE424_RS19820 (NE424_19820) 92648..93616 - 969 WP_012308653.1 IS30 family transposase -
NE424_RS19825 (NE424_19825) 93753..94532 - 780 WP_000422636.1 aminoglycoside O-phosphotransferase APH(3')-VIa -
NE424_RS19830 (NE424_19830) 94633..95601 - 969 WP_012308653.1 IS30 family transposase -
NE424_RS19835 (NE424_19835) 95703..95933 - 231 WP_080768161.1 lysine transporter LysE -
NE424_RS19840 (NE424_19840) 95983..96810 - 828 WP_000073658.1 AraC family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 / blaNDM-1 - 1..141631 141631
- inside IScluster/Tn aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 - 72780..106272 33492


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-88)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(41-96)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11304.70 Da        Isoelectric Point: 5.6205

>T248097 WP_000438825.1 NZ_CP098796:91615-91902 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG

Download         Length: 288 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12200.86 Da        Isoelectric Point: 8.4628

>AT248097 WP_004728120.1 NZ_CP098796:91889-92203 [Acinetobacter baumannii]
MSMVRYSRKELNEKFGEKQDAEIQRLLAKGTVPDDQLDLSDIPEITDWSSAVRQNQFYRPVKQQTSIRLDADVLAWFKAQ
GKGYQTRMNEILRDAMLKELKNHQ

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TVQ4

Antitoxin

Source ID Structure
AlphaFold DB A0A0A8TRI9

References