Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 91433..92021 | Replicon | plasmid p1VB280820 |
| Accession | NZ_CP098792 | ||
| Organism | Acinetobacter baumannii strain 280820 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | N8SM64 |
| Locus tag | NE421_RS20185 | Protein ID | WP_000438825.1 |
| Coordinates | 91734..92021 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | D3JXQ4 |
| Locus tag | NE421_RS20180 | Protein ID | WP_004728120.1 |
| Coordinates | 91433..91747 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE421_RS20145 (NE421_20145) | 86605..86925 | - | 321 | WP_000897307.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NE421_RS20150 (NE421_20150) | 87065..87484 | + | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
| NE421_RS20155 (NE421_20155) | 87584..88792 | - | 1209 | WP_042090285.1 | IS256 family transposase | - |
| NE421_RS20160 (NE421_20160) | 88892..89173 | - | 282 | WP_000985609.1 | putative addiction module antidote protein | - |
| NE421_RS20165 (NE421_20165) | 89174..89476 | - | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NE421_RS20170 (NE421_20170) | 89769..90859 | + | 1091 | WP_252172194.1 | IS4-like element ISAba33 family transposase | - |
| NE421_RS20175 (NE421_20175) | 90856..91344 | + | 489 | WP_252172183.1 | hypothetical protein | - |
| NE421_RS20180 (NE421_20180) | 91433..91747 | - | 315 | WP_004728120.1 | BrnA antitoxin family protein | Antitoxin |
| NE421_RS20185 (NE421_20185) | 91734..92021 | - | 288 | WP_000438825.1 | BrnT family toxin | Toxin |
| NE421_RS20190 (NE421_20190) | 92251..92649 | - | 399 | WP_080768162.1 | LysE family transporter | - |
| NE421_RS20195 (NE421_20195) | 92646..93614 | - | 969 | WP_012308653.1 | IS30 family transposase | - |
| NE421_RS20200 (NE421_20200) | 93751..94530 | - | 780 | WP_000422636.1 | aminoglycoside O-phosphotransferase APH(3')-VIa | - |
| NE421_RS20205 (NE421_20205) | 94631..95599 | - | 969 | WP_012308653.1 | IS30 family transposase | - |
| NE421_RS20210 (NE421_20210) | 95701..95931 | - | 231 | WP_080768161.1 | lysine transporter LysE | - |
| NE421_RS20215 (NE421_20215) | 95981..96808 | - | 828 | WP_000073658.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 / blaNDM-1 | - | 1..141629 | 141629 | |
| - | inside | IScluster/Tn | aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 | - | 72778..106270 | 33492 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11304.70 Da Isoelectric Point: 5.6205
>T248093 WP_000438825.1 NZ_CP098792:c92021-91734 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8TVQ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A8TRI9 |