248093

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) BrnTA/BrnT-BrnA
Location 91433..92021 Replicon plasmid p1VB280820
Accession NZ_CP098792
Organism Acinetobacter baumannii strain 280820

Toxin (Protein)


Gene name brnT Uniprot ID N8SM64
Locus tag NE421_RS20185 Protein ID WP_000438825.1
Coordinates 91734..92021 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name brnA Uniprot ID D3JXQ4
Locus tag NE421_RS20180 Protein ID WP_004728120.1
Coordinates 91433..91747 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE421_RS20145 (NE421_20145) 86605..86925 - 321 WP_000897307.1 type II toxin-antitoxin system RelE/ParE family toxin -
NE421_RS20150 (NE421_20150) 87065..87484 + 420 WP_001180106.1 SMI1/KNR4 family protein -
NE421_RS20155 (NE421_20155) 87584..88792 - 1209 WP_042090285.1 IS256 family transposase -
NE421_RS20160 (NE421_20160) 88892..89173 - 282 WP_000985609.1 putative addiction module antidote protein -
NE421_RS20165 (NE421_20165) 89174..89476 - 303 WP_000286964.1 type II toxin-antitoxin system RelE/ParE family toxin -
NE421_RS20170 (NE421_20170) 89769..90859 + 1091 WP_252172194.1 IS4-like element ISAba33 family transposase -
NE421_RS20175 (NE421_20175) 90856..91344 + 489 WP_252172183.1 hypothetical protein -
NE421_RS20180 (NE421_20180) 91433..91747 - 315 WP_004728120.1 BrnA antitoxin family protein Antitoxin
NE421_RS20185 (NE421_20185) 91734..92021 - 288 WP_000438825.1 BrnT family toxin Toxin
NE421_RS20190 (NE421_20190) 92251..92649 - 399 WP_080768162.1 LysE family transporter -
NE421_RS20195 (NE421_20195) 92646..93614 - 969 WP_012308653.1 IS30 family transposase -
NE421_RS20200 (NE421_20200) 93751..94530 - 780 WP_000422636.1 aminoglycoside O-phosphotransferase APH(3')-VIa -
NE421_RS20205 (NE421_20205) 94631..95599 - 969 WP_012308653.1 IS30 family transposase -
NE421_RS20210 (NE421_20210) 95701..95931 - 231 WP_080768161.1 lysine transporter LysE -
NE421_RS20215 (NE421_20215) 95981..96808 - 828 WP_000073658.1 AraC family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 / blaNDM-1 - 1..141629 141629
- inside IScluster/Tn aac(3)-IId / aph(3'')-Ib / mph(E) / msr(E) / aph(3')-VIa / blaOXA-58 / sul1 / qacE / blaCARB-2 - 72778..106270 33492


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(7-88)

Antitoxin

BrnA antitoxin of type II toxin-antitoxin system

(41-96)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11304.70 Da        Isoelectric Point: 5.6205

>T248093 WP_000438825.1 NZ_CP098792:c92021-91734 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG

Download         Length: 288 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12200.86 Da        Isoelectric Point: 8.4628

>AT248093 WP_004728120.1 NZ_CP098792:c91747-91433 [Acinetobacter baumannii]
MSMVRYSRKELNEKFGEKQDAEIQRLLAKGTVPDDQLDLSDIPEITDWSSAVRQNQFYRPVKQQTSIRLDADVLAWFKAQ
GKGYQTRMNEILRDAMLKELKNHQ

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A8TVQ4

Antitoxin

Source ID Structure
AlphaFold DB A0A0A8TRI9

References