Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 3670205..3670858 | Replicon | chromosome |
| Accession | NZ_CP098791 | ||
| Organism | Acinetobacter baumannii strain 280820 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A3R9G864 |
| Locus tag | NE421_RS17395 | Protein ID | WP_000607075.1 |
| Coordinates | 3670205..3670594 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | NE421_RS17400 | Protein ID | WP_001288210.1 |
| Coordinates | 3670601..3670858 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NE421_RS17380 (NE421_17380) | 3665323..3667518 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
| NE421_RS17385 (NE421_17385) | 3667706..3668272 | - | 567 | WP_000651536.1 | rhombosortase | - |
| NE421_RS17390 (NE421_17390) | 3668350..3669435 | - | 1086 | WP_000049106.1 | hypothetical protein | - |
| NE421_RS17395 (NE421_17395) | 3670205..3670594 | - | 390 | WP_000607075.1 | membrane protein | Toxin |
| NE421_RS17400 (NE421_17400) | 3670601..3670858 | - | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NE421_RS17405 (NE421_17405) | 3671046..3672218 | + | 1173 | WP_032028213.1 | acyl-CoA dehydrogenase family protein | - |
| NE421_RS17410 (NE421_17410) | 3672267..3673757 | - | 1491 | WP_031966421.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NE421_RS17415 (NE421_17415) | 3673939..3674316 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| NE421_RS17420 (NE421_17420) | 3674335..3675342 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.94 Da Isoelectric Point: 10.3890
>T248090 WP_000607075.1 NZ_CP098791:c3670594-3670205 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKVIDYQIFIVIYFEGHKTLTSIIWFDQMSLVEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R9G864 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |