Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 215650..216176 | Replicon | plasmid pYQ13422-1 |
| Accession | NZ_CP098779 | ||
| Organism | Enterobacter hormaechei strain YQ13422hy | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | ND013_RS22965 | Protein ID | WP_000323025.1 |
| Coordinates | 215650..215937 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | ND013_RS22970 | Protein ID | WP_000534858.1 |
| Coordinates | 215937..216176 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND013_RS22930 | 211220..211396 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| ND013_RS22935 | 211907..212851 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| ND013_RS22940 | 212947..213549 | + | 603 | WP_012695474.1 | hypothetical protein | - |
| ND013_RS22945 | 213609..213959 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| ND013_RS22950 | 214006..214209 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| ND013_RS22955 | 214491..214811 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| ND013_RS22960 | 215424..215549 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
| ND013_RS22965 | 215650..215937 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| ND013_RS22970 | 215937..216176 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| ND013_RS22975 | 216201..216305 | + | 105 | Protein_229 | protein YdfV | - |
| ND013_RS22980 | 216439..217362 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| ND013_RS22985 | 217562..218134 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| ND013_RS22990 | 218610..219848 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mph(A) / aac(3)-IId / blaTEM-1B / blaSFO-1 / catA2 / tet(D) / blaSHV-12 / sul1 / blaDHA-1 / qnrB4 / qacE / ere(A) / aac(6')-IIc | - | 1..295136 | 295136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T248089 WP_000323025.1 NZ_CP098779:c215937-215650 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|