Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4487663..4488279 | Replicon | chromosome |
| Accession | NZ_CP098778 | ||
| Organism | Enterobacter hormaechei strain YQ13422hy | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | ND013_RS21435 | Protein ID | WP_077266491.1 |
| Coordinates | 4487663..4488034 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
| Locus tag | ND013_RS21440 | Protein ID | WP_015569912.1 |
| Coordinates | 4488037..4488279 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND013_RS21420 | 4485163..4486065 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
| ND013_RS21425 | 4486062..4486697 | + | 636 | WP_126499207.1 | formate dehydrogenase cytochrome b556 subunit | - |
| ND013_RS21430 | 4486694..4487623 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
| ND013_RS21435 | 4487663..4488034 | - | 372 | WP_077266491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ND013_RS21440 | 4488037..4488279 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| ND013_RS21445 | 4488478..4489398 | + | 921 | WP_126499206.1 | alpha/beta hydrolase | - |
| ND013_RS21450 | 4489407..4490348 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
| ND013_RS21455 | 4490393..4490830 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
| ND013_RS21460 | 4490827..4491708 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
| ND013_RS21465 | 4491702..4492301 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
| ND013_RS21470 | 4492420..4493220 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13723.85 Da Isoelectric Point: 6.4882
>T248087 WP_077266491.1 NZ_CP098778:c4488034-4487663 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|