Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2297222..2297961 | Replicon | chromosome |
| Accession | NZ_CP098778 | ||
| Organism | Enterobacter hormaechei strain YQ13422hy | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | ND013_RS11110 | Protein ID | WP_110293091.1 |
| Coordinates | 2297222..2297707 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | ND013_RS11115 | Protein ID | WP_003857131.1 |
| Coordinates | 2297695..2297961 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ND013_RS11085 | 2292763..2293521 | - | 759 | WP_126498540.1 | trans-aconitate 2-methyltransferase | - |
| ND013_RS11090 | 2293606..2294190 | - | 585 | WP_126498541.1 | NUDIX domain-containing protein | - |
| ND013_RS11095 | 2294277..2295035 | + | 759 | WP_015570520.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| ND013_RS11100 | 2295140..2296432 | + | 1293 | WP_126498542.1 | glycosyl hydrolase family 28 protein | - |
| ND013_RS11105 | 2296432..2297046 | + | 615 | WP_080338042.1 | NUDIX hydrolase | - |
| ND013_RS11110 | 2297222..2297707 | - | 486 | WP_110293091.1 | GNAT family N-acetyltransferase | Toxin |
| ND013_RS11115 | 2297695..2297961 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| ND013_RS11120 | 2298025..2298954 | - | 930 | WP_110293092.1 | LysR family transcriptional regulator | - |
| ND013_RS11125 | 2299083..2300471 | + | 1389 | WP_126498675.1 | MFS transporter | - |
| ND013_RS11130 | 2300494..2301489 | - | 996 | WP_110293093.1 | DUF2891 domain-containing protein | - |
| ND013_RS11135 | 2301499..2302485 | - | 987 | WP_110293094.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2287193..2297961 | 10768 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17544.24 Da Isoelectric Point: 9.9658
>T248079 WP_110293091.1 NZ_CP098778:c2297707-2297222 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIVLARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAMMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIVLARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAMMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|