Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 3873871..3874556 | Replicon | chromosome |
Accession | NZ_CP098777 | ||
Organism | Cronobacter sakazakii strain JXES-28 |
Toxin (Protein)
Gene name | tad | Uniprot ID | - |
Locus tag | NES82_RS18810 | Protein ID | WP_007852532.1 |
Coordinates | 3874206..3874556 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | - |
Locus tag | NES82_RS18805 | Protein ID | WP_161574668.1 |
Coordinates | 3873871..3874209 (-) | Length | 113 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NES82_RS18785 (NES82_18790) | 3869195..3870328 | - | 1134 | WP_007871440.1 | slipin family protein | - |
NES82_RS18790 (NES82_18795) | 3870804..3872396 | + | 1593 | WP_161574667.1 | RNA repair transcriptional activator RtcR | - |
NES82_RS18795 (NES82_18800) | 3872558..3873493 | + | 936 | WP_004387518.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
NES82_RS18800 (NES82_18805) | 3873584..3873856 | + | 273 | WP_007702377.1 | DUF3811 domain-containing protein | - |
NES82_RS18805 (NES82_18810) | 3873871..3874209 | - | 339 | WP_161574668.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NES82_RS18810 (NES82_18815) | 3874206..3874556 | - | 351 | WP_007852532.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NES82_RS18815 (NES82_18820) | 3874773..3875078 | + | 306 | WP_014727945.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
NES82_RS18820 (NES82_18825) | 3875083..3875358 | + | 276 | WP_007852536.1 | putative addiction module antidote protein | - |
NES82_RS18825 (NES82_18830) | 3875375..3877006 | - | 1632 | WP_007852537.1 | Na/Pi cotransporter family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.99 Da Isoelectric Point: 10.2932
>T248072 WP_007852532.1 NZ_CP098777:c3874556-3874206 [Cronobacter sakazakii]
MIKPLFWVGQARKDLQALPEDVQDLFGYALYLAQQGRRHPQARPLKGFGGAGVLEVVEDYQGNAFRAVYTVRLGEAIYVL
HVFQKKSSSGIATPRPEMEKIEQRLKAAQRHAGGLK
MIKPLFWVGQARKDLQALPEDVQDLFGYALYLAQQGRRHPQARPLKGFGGAGVLEVVEDYQGNAFRAVYTVRLGEAIYVL
HVFQKKSSSGIATPRPEMEKIEQRLKAAQRHAGGLK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|