Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3678351..3678870 | Replicon | chromosome |
Accession | NZ_CP098777 | ||
Organism | Cronobacter sakazakii strain JXES-28 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NES82_RS17880 | Protein ID | WP_004385271.1 |
Coordinates | 3678351..3678638 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NES82_RS17885 | Protein ID | WP_105579789.1 |
Coordinates | 3678628..3678870 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NES82_RS17860 (NES82_17865) | 3673433..3673963 | - | 531 | WP_105608413.1 | NAD(P)H-dependent oxidoreductase | - |
NES82_RS17865 (NES82_17870) | 3674066..3674947 | + | 882 | WP_161574629.1 | LysR family transcriptional regulator | - |
NES82_RS17870 (NES82_17875) | 3675244..3677379 | + | 2136 | WP_105944704.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NES82_RS17875 (NES82_17880) | 3677879..3678343 | + | 465 | WP_007897806.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NES82_RS17880 (NES82_17885) | 3678351..3678638 | - | 288 | WP_004385271.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NES82_RS17885 (NES82_17890) | 3678628..3678870 | - | 243 | WP_105579789.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NES82_RS17890 (NES82_17895) | 3678948..3680858 | - | 1911 | WP_161574630.1 | PRD domain-containing protein | - |
NES82_RS17895 (NES82_17900) | 3680972..3681712 | - | 741 | WP_161574631.1 | KDGP aldolase family protein | - |
NES82_RS17900 (NES82_17905) | 3681709..3682827 | - | 1119 | WP_161574632.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10811.80 Da Isoelectric Point: 10.5836
>T248071 WP_004385271.1 NZ_CP098777:c3678638-3678351 [Cronobacter sakazakii]
MSYKLVFDPRALKEWHKLGETVKAQFKKKLAHVLAAPRVKSARLSGLPDCYKIKLRTSGYRLVYQVRDDAVCVLVIAIGK
RENLTVYQGAGHRLE
MSYKLVFDPRALKEWHKLGETVKAQFKKKLAHVLAAPRVKSARLSGLPDCYKIKLRTSGYRLVYQVRDDAVCVLVIAIGK
RENLTVYQGAGHRLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|