Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3515600..3516263 | Replicon | chromosome |
| Accession | NZ_CP098777 | ||
| Organism | Cronobacter sakazakii strain JXES-28 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | NES82_RS17110 | Protein ID | WP_097564054.1 |
| Coordinates | 3515600..3516016 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A3Q9CFW7 |
| Locus tag | NES82_RS17115 | Protein ID | WP_007870701.1 |
| Coordinates | 3515997..3516263 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NES82_RS17090 (NES82_17095) | 3511588..3513321 | - | 1734 | WP_007870697.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NES82_RS17095 (NES82_17100) | 3513325..3514044 | - | 720 | WP_004385678.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NES82_RS17100 (NES82_17105) | 3514067..3514963 | - | 897 | WP_161574673.1 | site-specific tyrosine recombinase XerD | - |
| NES82_RS17105 (NES82_17110) | 3515065..3515586 | + | 522 | WP_004385676.1 | flavodoxin FldB | - |
| NES82_RS17110 (NES82_17115) | 3515600..3516016 | - | 417 | WP_097564054.1 | protein YgfX | Toxin |
| NES82_RS17115 (NES82_17120) | 3515997..3516263 | - | 267 | WP_007870701.1 | FAD assembly factor SdhE | Antitoxin |
| NES82_RS17120 (NES82_17125) | 3516541..3517530 | + | 990 | WP_069681646.1 | tRNA-modifying protein YgfZ | - |
| NES82_RS17125 (NES82_17130) | 3517635..3518288 | - | 654 | WP_007777939.1 | hemolysin III family protein | - |
| NES82_RS17130 (NES82_17135) | 3518431..3518745 | - | 315 | WP_069681647.1 | N(4)-acetylcytidine aminohydrolase | - |
| NES82_RS17135 (NES82_17140) | 3518921..3519649 | + | 729 | WP_032805608.1 | MurR/RpiR family transcriptional regulator | - |
| NES82_RS17140 (NES82_17145) | 3519801..3521234 | + | 1434 | WP_161574592.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16388.39 Da Isoelectric Point: 10.8220
>T248070 WP_097564054.1 NZ_CP098777:c3516016-3515600 [Cronobacter sakazakii]
VVLWHSDLRVSWRSQWLSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFQGEVSLTADYHLRWQGV
DWQICATPWMLRSGMMLRLRHPKTTRCHHVWLAADSMTEAEWRDLRRLLLQQPVGDKR
VVLWHSDLRVSWRSQWLSLLLHGAVAVIILLLPWPLRYLPVWMLLLSLVVFDCVRSQRRINAFQGEVSLTADYHLRWQGV
DWQICATPWMLRSGMMLRLRHPKTTRCHHVWLAADSMTEAEWRDLRRLLLQQPVGDKR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|