Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 3329621..3330288 | Replicon | chromosome |
| Accession | NZ_CP098777 | ||
| Organism | Cronobacter sakazakii strain JXES-28 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A6S5KU07 |
| Locus tag | NES82_RS16205 | Protein ID | WP_032613324.1 |
| Coordinates | 3329959..3330288 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A6S5KD22 |
| Locus tag | NES82_RS16200 | Protein ID | WP_032613322.1 |
| Coordinates | 3329621..3329938 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NES82_RS16160 (NES82_16165) | 3325159..3325992 | + | 834 | WP_032613306.1 | DUF932 domain-containing protein | - |
| NES82_RS16165 (NES82_16170) | 3326194..3326898 | + | 705 | WP_161574547.1 | WYL domain-containing protein | - |
| NES82_RS16170 (NES82_16175) | 3326895..3327509 | + | 615 | WP_032613310.1 | hypothetical protein | - |
| NES82_RS16175 (NES82_16180) | 3327599..3328009 | + | 411 | WP_032613312.1 | hypothetical protein | - |
| NES82_RS16180 (NES82_16185) | 3328087..3328326 | + | 240 | WP_032613314.1 | DUF905 domain-containing protein | - |
| NES82_RS16185 (NES82_16190) | 3328422..3328880 | + | 459 | WP_032613316.1 | antirestriction protein | - |
| NES82_RS16190 (NES82_16195) | 3328896..3329372 | + | 477 | WP_032613318.1 | RadC family protein | - |
| NES82_RS16195 (NES82_16200) | 3329381..3329602 | + | 222 | WP_032613320.1 | DUF987 domain-containing protein | - |
| NES82_RS16200 (NES82_16205) | 3329621..3329938 | + | 318 | WP_032613322.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NES82_RS16205 (NES82_16210) | 3329959..3330288 | + | 330 | WP_032613324.1 | TA system toxin CbtA family protein | Toxin |
| NES82_RS16210 (NES82_16215) | 3330645..3330926 | - | 282 | WP_161574548.1 | phage tail assembly protein | - |
| NES82_RS16215 (NES82_16220) | 3330987..3331508 | - | 522 | WP_161574549.1 | phage major tail tube protein | - |
| NES82_RS16220 (NES82_16225) | 3331523..3332710 | - | 1188 | WP_161574550.1 | phage tail sheath protein | - |
| NES82_RS16225 (NES82_16230) | 3332853..3333668 | - | 816 | WP_161574551.1 | hypothetical protein | - |
| NES82_RS16230 (NES82_16235) | 3333780..3334202 | - | 423 | WP_038886132.1 | tail fiber assembly protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3328422..3366974 | 38552 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12351.36 Da Isoelectric Point: 9.5982
>T248069 WP_032613324.1 NZ_CP098777:3329959-3330288 [Cronobacter sakazakii]
MKPQPATTSRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIQEHIDAAITLADAVNFLVEKYELVRIDRRGF
SWLQQTPYISVVDILRARRSTGLLKANVK
MKPQPATTSRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIQEHIDAAITLADAVNFLVEKYELVRIDRRGF
SWLQQTPYISVVDILRARRSTGLLKANVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6S5KU07 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6S5KD22 |