Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yfjZ-ypjF/CbtA-CbeA
Location 3329621..3330288 Replicon chromosome
Accession NZ_CP098777
Organism Cronobacter sakazakii strain JXES-28

Toxin (Protein)


Gene name ypjF Uniprot ID A0A6S5KU07
Locus tag NES82_RS16205 Protein ID WP_032613324.1
Coordinates 3329959..3330288 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID A0A6S5KD22
Locus tag NES82_RS16200 Protein ID WP_032613322.1
Coordinates 3329621..3329938 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NES82_RS16160 (NES82_16165) 3325159..3325992 + 834 WP_032613306.1 DUF932 domain-containing protein -
NES82_RS16165 (NES82_16170) 3326194..3326898 + 705 WP_161574547.1 WYL domain-containing protein -
NES82_RS16170 (NES82_16175) 3326895..3327509 + 615 WP_032613310.1 hypothetical protein -
NES82_RS16175 (NES82_16180) 3327599..3328009 + 411 WP_032613312.1 hypothetical protein -
NES82_RS16180 (NES82_16185) 3328087..3328326 + 240 WP_032613314.1 DUF905 domain-containing protein -
NES82_RS16185 (NES82_16190) 3328422..3328880 + 459 WP_032613316.1 antirestriction protein -
NES82_RS16190 (NES82_16195) 3328896..3329372 + 477 WP_032613318.1 RadC family protein -
NES82_RS16195 (NES82_16200) 3329381..3329602 + 222 WP_032613320.1 DUF987 domain-containing protein -
NES82_RS16200 (NES82_16205) 3329621..3329938 + 318 WP_032613322.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NES82_RS16205 (NES82_16210) 3329959..3330288 + 330 WP_032613324.1 TA system toxin CbtA family protein Toxin
NES82_RS16210 (NES82_16215) 3330645..3330926 - 282 WP_161574548.1 phage tail assembly protein -
NES82_RS16215 (NES82_16220) 3330987..3331508 - 522 WP_161574549.1 phage major tail tube protein -
NES82_RS16220 (NES82_16225) 3331523..3332710 - 1188 WP_161574550.1 phage tail sheath protein -
NES82_RS16225 (NES82_16230) 3332853..3333668 - 816 WP_161574551.1 hypothetical protein -
NES82_RS16230 (NES82_16235) 3333780..3334202 - 423 WP_038886132.1 tail fiber assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3328422..3366974 38552


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12351.36 Da        Isoelectric Point: 9.5982

>T248069 WP_032613324.1 NZ_CP098777:3329959-3330288 [Cronobacter sakazakii]
MKPQPATTSRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFSDETVIQEHIDAAITLADAVNFLVEKYELVRIDRRGF
SWLQQTPYISVVDILRARRSTGLLKANVK

Download         Length: 330 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11903.56 Da        Isoelectric Point: 6.6242

>AT248069 WP_032613322.1 NZ_CP098777:3329621-3329938 [Cronobacter sakazakii]
MSNITWGLQRDITPRLGARLVQEGNRLHYLADRASITGKFSDAECQKLDVAFPHFISQMESMLITGELNPRHAHCVILYH
NDFTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6S5KU07

Antitoxin

Source ID Structure
AlphaFold DB A0A6S5KD22

References