Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 2391771..2392330 | Replicon | chromosome |
| Accession | NZ_CP098774 | ||
| Organism | Sphingomonas sp. QA11 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NDN01_RS11160 | Protein ID | WP_272627447.1 |
| Coordinates | 2391771..2392064 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NDN01_RS11165 | Protein ID | WP_272627448.1 |
| Coordinates | 2392061..2392330 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDN01_RS11130 (NDN01_11100) | 2388485..2388817 | - | 333 | WP_272627443.1 | hypothetical protein | - |
| NDN01_RS11135 (NDN01_11105) | 2388810..2389553 | - | 744 | WP_272627444.1 | queuosine precursor transporter | - |
| NDN01_RS11145 (NDN01_11115) | 2389671..2391371 | - | 1701 | WP_272628167.1 | recombinase family protein | - |
| NDN01_RS11150 (NDN01_11120) | 2391380..2391619 | - | 240 | WP_272627445.1 | hypothetical protein | - |
| NDN01_RS11155 | 2391635..2391766 | - | 132 | WP_272627446.1 | hypothetical protein | - |
| NDN01_RS11160 (NDN01_11125) | 2391771..2392064 | - | 294 | WP_272627447.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NDN01_RS11165 (NDN01_11130) | 2392061..2392330 | - | 270 | WP_272627448.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| NDN01_RS11170 (NDN01_11135) | 2393001..2393315 | + | 315 | Protein_2210 | ParB/Srx family N-terminal domain-containing protein | - |
| NDN01_RS11175 (NDN01_11140) | 2393602..2393775 | - | 174 | WP_272627449.1 | hypothetical protein | - |
| NDN01_RS11180 (NDN01_11145) | 2393807..2394691 | - | 885 | WP_272627450.1 | hypothetical protein | - |
| NDN01_RS11185 (NDN01_11150) | 2394703..2395617 | - | 915 | WP_272627451.1 | arginase family protein | - |
| NDN01_RS11190 (NDN01_11155) | 2395804..2396676 | + | 873 | WP_272627452.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11440.11 Da Isoelectric Point: 9.5030
>T248058 WP_272627447.1 NZ_CP098774:c2392064-2391771 [Sphingomonas sp. QA11]
MRIKWTSKASSDLVRLHEHLQPVAPDAAARVVQQLARAPDRLLDYPRIGEKLEAYEPREVRRIIVGNYELRYEIADATIF
ILRLWHARENRSFKSEE
MRIKWTSKASSDLVRLHEHLQPVAPDAAARVVQQLARAPDRLLDYPRIGEKLEAYEPREVRRIIVGNYELRYEIADATIF
ILRLWHARENRSFKSEE
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|