Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 4862125..4862641 Replicon chromosome
Accession NZ_CP098770
Organism Klebsiella pneumoniae strain TH12845

Toxin (Protein)


Gene name relE Uniprot ID J2XDK6
Locus tag NE242_RS23970 Protein ID WP_002886902.1
Coordinates 4862125..4862409 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID R4Y888
Locus tag NE242_RS23975 Protein ID WP_002886901.1
Coordinates 4862399..4862641 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE242_RS23945 (NE242_23945) 4857609..4857872 - 264 WP_004152271.1 PTS sugar transporter subunit IIB -
NE242_RS23950 (NE242_23950) 4858002..4858175 + 174 WP_002886906.1 hypothetical protein -
NE242_RS23955 (NE242_23955) 4858178..4858921 + 744 WP_002886905.1 MurR/RpiR family transcriptional regulator -
NE242_RS23960 (NE242_23960) 4859278..4861416 + 2139 WP_002886904.1 anaerobic ribonucleoside-triphosphate reductase -
NE242_RS23965 (NE242_23965) 4861657..4862121 + 465 WP_002886903.1 anaerobic ribonucleoside-triphosphate reductase-activating protein -
NE242_RS23970 (NE242_23970) 4862125..4862409 - 285 WP_002886902.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NE242_RS23975 (NE242_23975) 4862399..4862641 - 243 WP_002886901.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NE242_RS23980 (NE242_23980) 4862719..4864629 - 1911 WP_004152270.1 PRD domain-containing protein -
NE242_RS23985 (NE242_23985) 4864652..4865806 - 1155 WP_002886900.1 lactonase family protein -
NE242_RS23990 (NE242_23990) 4865872..4866612 - 741 WP_002886899.1 KDGP aldolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element sul1 / qacE / aadA2 / cmlA1 / ant(2'')-Ia - 4811499..5020656 209157


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-82)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-80)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11125.95 Da        Isoelectric Point: 10.3787

>T248053 WP_002886902.1 NZ_CP098770:c4862409-4862125 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9045.55 Da        Isoelectric Point: 6.3340

>AT248053 WP_002886901.1 NZ_CP098770:c4862641-4862399 [Klebsiella pneumoniae]
MATLNVRLDDKLKKEAYAVLEKLDMTPTEAVRLLFQYIAENGRMPVKSMTISDGEAALLRTVRERLENPRPGVKVSLDDL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GMH2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GLP0

References