Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4146132..4146751 Replicon chromosome
Accession NZ_CP098770
Organism Klebsiella pneumoniae strain TH12845

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NE242_RS20530 Protein ID WP_002892050.1
Coordinates 4146533..4146751 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NE242_RS20525 Protein ID WP_002892066.1
Coordinates 4146132..4146506 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE242_RS20515 (NE242_20515) 4141284..4142477 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NE242_RS20520 (NE242_20520) 4142500..4145646 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NE242_RS20525 (NE242_20525) 4146132..4146506 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NE242_RS20530 (NE242_20530) 4146533..4146751 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NE242_RS20535 (NE242_20535) 4146910..4147476 + 567 WP_002892030.1 maltose O-acetyltransferase -
NE242_RS20540 (NE242_20540) 4147448..4147588 - 141 WP_004147370.1 hypothetical protein -
NE242_RS20545 (NE242_20545) 4147609..4148079 + 471 WP_002892026.1 YlaC family protein -
NE242_RS20550 (NE242_20550) 4148054..4149505 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NE242_RS20555 (NE242_20555) 4149606..4150304 + 699 WP_002892021.1 GNAT family protein -
NE242_RS20560 (NE242_20560) 4150301..4150441 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NE242_RS20565 (NE242_20565) 4150441..4150704 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T248051 WP_002892050.1 NZ_CP098770:4146533-4146751 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT248051 WP_002892066.1 NZ_CP098770:4146132-4146506 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References