Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4092248..4092867 Replicon chromosome
Accession NZ_CP098769
Organism Klebsiella pneumoniae strain TH12846

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NE243_RS20270 Protein ID WP_002892050.1
Coordinates 4092649..4092867 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NE243_RS20265 Protein ID WP_002892066.1
Coordinates 4092248..4092622 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NE243_RS20255 (NE243_20255) 4087400..4088593 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NE243_RS20260 (NE243_20260) 4088616..4091762 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NE243_RS20265 (NE243_20265) 4092248..4092622 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NE243_RS20270 (NE243_20270) 4092649..4092867 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NE243_RS20275 (NE243_20275) 4093026..4093592 + 567 WP_002892030.1 maltose O-acetyltransferase -
NE243_RS20280 (NE243_20280) 4093564..4093704 - 141 WP_004147370.1 hypothetical protein -
NE243_RS20285 (NE243_20285) 4093725..4094195 + 471 WP_002892026.1 YlaC family protein -
NE243_RS20290 (NE243_20290) 4094170..4095621 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NE243_RS20295 (NE243_20295) 4095722..4096420 + 699 WP_002892021.1 GNAT family protein -
NE243_RS20300 (NE243_20300) 4096417..4096557 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NE243_RS20305 (NE243_20305) 4096557..4096820 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T248037 WP_002892050.1 NZ_CP098769:4092649-4092867 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT248037 WP_002892066.1 NZ_CP098769:4092248-4092622 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References