Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 876817..877471 | Replicon | chromosome |
Accession | NZ_CP098769 | ||
Organism | Klebsiella pneumoniae strain TH12846 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R4YHX2 |
Locus tag | NE243_RS04435 | Protein ID | WP_004144731.1 |
Coordinates | 877064..877471 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NE243_RS04430 | Protein ID | WP_002916312.1 |
Coordinates | 876817..877083 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NE243_RS04405 (NE243_04405) | 871973..873406 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
NE243_RS04410 (NE243_04410) | 873525..874253 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NE243_RS04415 (NE243_04415) | 874303..874614 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
NE243_RS04420 (NE243_04420) | 874778..875437 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
NE243_RS04425 (NE243_04425) | 875588..876571 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
NE243_RS04430 (NE243_04430) | 876817..877083 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NE243_RS04435 (NE243_04435) | 877064..877471 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
NE243_RS04440 (NE243_04440) | 877478..877999 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
NE243_RS04445 (NE243_04445) | 878100..878996 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NE243_RS04450 (NE243_04450) | 879019..879731 | + | 713 | Protein_875 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NE243_RS04455 (NE243_04455) | 879737..881468 | + | 1732 | Protein_876 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T248031 WP_004144731.1 NZ_CP098769:877064-877471 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378E4P6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |