Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpA-brnA/BrnT-BrnA |
Location | 54879..55464 | Replicon | plasmid unnamed2 |
Accession | NZ_CP098764 | ||
Organism | Sphingomonas aerolata strain PDD-32b-11 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | NEF64_RS18705 | Protein ID | WP_159513481.1 |
Coordinates | 55138..55464 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | - |
Locus tag | NEF64_RS18700 | Protein ID | WP_082446612.1 |
Coordinates | 54879..55157 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NEF64_RS18675 (NEF64_18675) | 49968..50192 | - | 225 | WP_133192513.1 | conjugal transfer protein TraD | - |
NEF64_RS18680 (NEF64_18680) | 50206..50535 | - | 330 | WP_252574998.1 | conjugal transfer protein TraD | - |
NEF64_RS18685 (NEF64_18685) | 50710..53625 | + | 2916 | WP_252575000.1 | Ti-type conjugative transfer relaxase TraA | - |
NEF64_RS18690 (NEF64_18690) | 53629..54366 | + | 738 | WP_156360267.1 | DUF6118 family protein | - |
NEF64_RS18695 (NEF64_18695) | 54402..54746 | + | 345 | WP_156360266.1 | hypothetical protein | - |
NEF64_RS18700 (NEF64_18700) | 54879..55157 | - | 279 | WP_082446612.1 | BrnA antitoxin family protein | Antitoxin |
NEF64_RS18705 (NEF64_18705) | 55138..55464 | - | 327 | WP_159513481.1 | BrnT family toxin | Toxin |
NEF64_RS18710 (NEF64_18710) | 55528..56025 | - | 498 | WP_235516303.1 | hypothetical protein | - |
NEF64_RS18715 (NEF64_18715) | 56069..56632 | - | 564 | WP_252575002.1 | recombinase family protein | - |
NEF64_RS18720 (NEF64_18720) | 56819..57001 | + | 183 | WP_252575005.1 | hypothetical protein | - |
NEF64_RS18725 (NEF64_18725) | 57078..57410 | + | 333 | WP_252575082.1 | YnfA family protein | - |
NEF64_RS18730 (NEF64_18730) | 57622..57978 | + | 357 | Protein_49 | recombinase family protein | - |
NEF64_RS18735 (NEF64_18735) | 58268..59434 | + | 1167 | WP_252575012.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | - | 1..77112 | 77112 | |
- | flank | IS/Tn | - | - | 56069..56632 | 563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12174.80 Da Isoelectric Point: 6.0798
>T248026 WP_159513481.1 NZ_CP098764:c55464-55138 [Sphingomonas aerolata]
MGCTYNIVNAGVGVSFEWDDRKAVFNLAKHGVSFELAKEVWNDPLHVIIPDRVEGAEQRWHALGLVGPIVVLVVVHSYPD
AGDEDRIRIISARKATKQERYRYEQEGA
MGCTYNIVNAGVGVSFEWDDRKAVFNLAKHGVSFELAKEVWNDPLHVIIPDRVEGAEQRWHALGLVGPIVVLVVVHSYPD
AGDEDRIRIISARKATKQERYRYEQEGA
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|