Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpA-brnA/BrnT-BrnA |
| Location | 54879..55464 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP098764 | ||
| Organism | Sphingomonas aerolata strain PDD-32b-11 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NEF64_RS18705 | Protein ID | WP_159513481.1 |
| Coordinates | 55138..55464 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | - |
| Locus tag | NEF64_RS18700 | Protein ID | WP_082446612.1 |
| Coordinates | 54879..55157 (-) | Length | 93 a.a. |
Genomic Context
Location: 50710..53625 (2916 bp)
Type: Others
Protein ID: WP_252575000.1
Type: Others
Protein ID: WP_252575000.1
Location: 53629..54366 (738 bp)
Type: Others
Protein ID: WP_156360267.1
Type: Others
Protein ID: WP_156360267.1
Location: 54402..54746 (345 bp)
Type: Others
Protein ID: WP_156360266.1
Type: Others
Protein ID: WP_156360266.1
Location: 56819..57001 (183 bp)
Type: Others
Protein ID: WP_252575005.1
Type: Others
Protein ID: WP_252575005.1
Location: 57078..57410 (333 bp)
Type: Others
Protein ID: WP_252575082.1
Type: Others
Protein ID: WP_252575082.1
Location: 57622..57978 (357 bp)
Type: Others
Protein ID: Protein_49
Type: Others
Protein ID: Protein_49
Location: 58268..59434 (1167 bp)
Type: Others
Protein ID: WP_252575012.1
Type: Others
Protein ID: WP_252575012.1
Location: 49968..50192 (225 bp)
Type: Others
Protein ID: WP_133192513.1
Type: Others
Protein ID: WP_133192513.1
Location: 50206..50535 (330 bp)
Type: Others
Protein ID: WP_252574998.1
Type: Others
Protein ID: WP_252574998.1
Location: 54879..55157 (279 bp)
Type: Antitoxin
Protein ID: WP_082446612.1
Type: Antitoxin
Protein ID: WP_082446612.1
Location: 55138..55464 (327 bp)
Type: Toxin
Protein ID: WP_159513481.1
Type: Toxin
Protein ID: WP_159513481.1
Location: 55528..56025 (498 bp)
Type: Others
Protein ID: WP_235516303.1
Type: Others
Protein ID: WP_235516303.1
Location: 56069..56632 (564 bp)
Type: Others
Protein ID: WP_252575002.1
Type: Others
Protein ID: WP_252575002.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NEF64_RS18675 (NEF64_18675) | 49968..50192 | - | 225 | WP_133192513.1 | conjugal transfer protein TraD | - |
| NEF64_RS18680 (NEF64_18680) | 50206..50535 | - | 330 | WP_252574998.1 | conjugal transfer protein TraD | - |
| NEF64_RS18685 (NEF64_18685) | 50710..53625 | + | 2916 | WP_252575000.1 | Ti-type conjugative transfer relaxase TraA | - |
| NEF64_RS18690 (NEF64_18690) | 53629..54366 | + | 738 | WP_156360267.1 | DUF6118 family protein | - |
| NEF64_RS18695 (NEF64_18695) | 54402..54746 | + | 345 | WP_156360266.1 | hypothetical protein | - |
| NEF64_RS18700 (NEF64_18700) | 54879..55157 | - | 279 | WP_082446612.1 | BrnA antitoxin family protein | Antitoxin |
| NEF64_RS18705 (NEF64_18705) | 55138..55464 | - | 327 | WP_159513481.1 | BrnT family toxin | Toxin |
| NEF64_RS18710 (NEF64_18710) | 55528..56025 | - | 498 | WP_235516303.1 | hypothetical protein | - |
| NEF64_RS18715 (NEF64_18715) | 56069..56632 | - | 564 | WP_252575002.1 | recombinase family protein | - |
| NEF64_RS18720 (NEF64_18720) | 56819..57001 | + | 183 | WP_252575005.1 | hypothetical protein | - |
| NEF64_RS18725 (NEF64_18725) | 57078..57410 | + | 333 | WP_252575082.1 | YnfA family protein | - |
| NEF64_RS18730 (NEF64_18730) | 57622..57978 | + | 357 | Protein_49 | recombinase family protein | - |
| NEF64_RS18735 (NEF64_18735) | 58268..59434 | + | 1167 | WP_252575012.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..77112 | 77112 | |
| - | flank | IS/Tn | - | - | 56069..56632 | 563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12174.80 Da Isoelectric Point: 6.0798
>T248026 WP_159513481.1 NZ_CP098764:c55464-55138 [Sphingomonas aerolata]
MGCTYNIVNAGVGVSFEWDDRKAVFNLAKHGVSFELAKEVWNDPLHVIIPDRVEGAEQRWHALGLVGPIVVLVVVHSYPD
AGDEDRIRIISARKATKQERYRYEQEGA
MGCTYNIVNAGVGVSFEWDDRKAVFNLAKHGVSFELAKEVWNDPLHVIIPDRVEGAEQRWHALGLVGPIVVLVVVHSYPD
AGDEDRIRIISARKATKQERYRYEQEGA
Download Length: 327 bp