Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 4656..5236 | Replicon | plasmid pKP167-10 |
Accession | NZ_CP098761 | ||
Organism | Klebsiella pneumoniae strain KP167 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | ND678_RS27760 | Protein ID | WP_071177730.1 |
Coordinates | 4656..4970 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | ND678_RS27765 | Protein ID | WP_000093040.1 |
Coordinates | 4958..5236 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ND678_RS27735 (ND678_27725) | 600..2564 | + | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
ND678_RS27740 (ND678_27730) | 2564..3295 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
ND678_RS27745 (ND678_27735) | 3302..3832 | + | 531 | WP_071177729.1 | hypothetical protein | - |
ND678_RS27750 (ND678_27740) | 3859..4038 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
ND678_RS27755 (ND678_27745) | 4064..4492 | - | 429 | WP_001140599.1 | hypothetical protein | - |
ND678_RS27760 (ND678_27750) | 4656..4970 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ND678_RS27765 (ND678_27755) | 4958..5236 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
ND678_RS27770 (ND678_27760) | 5411..5776 | - | 366 | WP_072354022.1 | TonB family protein | - |
ND678_RS27775 (ND678_27765) | 5773..6144 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
ND678_RS27780 (ND678_27770) | 6418..6663 | - | 246 | WP_032440458.1 | hypothetical protein | - |
ND678_RS27785 (ND678_27775) | 6990..8675 | + | 1686 | WP_032440457.1 | colicin-like bacteriocin tRNase domain-containing protein | - |
ND678_RS27790 (ND678_27780) | 8685..8942 | + | 258 | WP_032440455.1 | colicin E3-like toxin immunity protein | - |
ND678_RS27795 (ND678_27785) | 9027..9176 | + | 150 | WP_032440454.1 | colicin release lysis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..10060 | 10060 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T248025 WP_071177730.1 NZ_CP098761:c4970-4656 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|